Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

(Cys²⁶)-Amyloid β-Protein (1-40) trifluoroacetate salt
H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Cys-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH trifluoroacetate salt

4060051

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4060051.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 265.00
CHF 246.45 (7%)
4060051.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 500.00
CHF 465.00 (7%)

Details

Aβ40 S26C has been used for generating the covalently linked Aβ40 homodimer. Dimerization can be easily reverted by reducing the soluble dimer with thiols as β-mercaptoethanol. Aβ40 S26C is perfectly suited for labeling with fluorescent tags
Catalog Number H-7402
One Letter Code DAEFRHDSGYEVHHQKLVFFAEDVGCNKGAIIGLMVGGVV
Synonyms Amyloid β-Protein (1-40) S26C
Molecular Formula C₁₉₄H₂₉₅N₅₃O₅₇S₂
Relative Molecular Mass 4345.93
CAS Registry Number [1678415-32-1] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Alzheimer's Disease