Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4060051
Return to Previous Page
4060051

Availability: In stock

(Cys²⁶)-Amyloid β-Protein (1-40) trifluoroacetate salt
H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Cys-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH trifluoroacetate salt

4060051

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4060051.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 265.00
CHF 246.45 (7%)
4060051.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 500.00
CHF 465.00 (7%)

Details

Aβ40 S26C has been used for generating the covalently linked Aβ40 homodimer. Dimerization can be easily reverted by reducing the soluble dimer with thiols as β-mercaptoethanol. Aβ40 S26C is perfectly suited for labeling with fluorescent tags
Catalog Number H-7402
One Letter Code DAEFRHDSGYEVHHQKLVFFAEDVGCNKGAIIGLMVGGVV
Synonyms Amyloid β-Protein (1-40) S26C
Molecular Formula C₁₉₄H₂₉₅N₅₃O₅₇S₂
Relative Molecular Mass 4345.93
CAS Registry Number [1678415-32-1] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Alzheimer's Disease
Links / Documents:
Brochures:

Product citations

M.Jin et al., Proc. Natl. Acad. Sci. USA, 108, 5819 (2011)
I.Mikhalyov et al., Biophys. J., 99, 1510 (2010)
B.O'Nuallain et al., J. Neurosci., 30, 14411 (2010)
G.M.Shankar et al., Nat. Med., 14, 837 (2008)