Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Preptin (human) trifluoroacetate salt
H-Asp-Val-Ser-Thr-Pro-Pro-Thr-Val-Leu-Pro-Asp-Asn-Phe-Pro-Arg-Tyr-Pro-Val-Gly-Lys-Phe-Phe-Gln-Tyr-Asp-Thr-Trp-Lys-Gln-Ser-Thr-Gln-Arg-Leu-OH trifluoroacetate salt

4059088

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4059088.0001 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 263.00
CHF 244.59 (7%)
4059088.0005 5 mg Ships within 3-5 business days  
CHF 1,051.00
CHF 977.43 (7%)
Add to Wish List
Add to Compare

Details

Preptin is a 34-amino acid peptide hormone, corresponding to Asp⁶⁹-Leu¹⁰² of the proinsulin-like growth factor II E-peptide. It is co-secreted with insulin and amylin from the pancreatic β-cells and is a physiological amplifier of glucose-mediated insulin secretion. It is also anabolic to bone tissue and may contribute to the preservation of bone mass observed in hyperinsulinemic states such as obesity.
Catalog Number H-6568
APC Number 50-1-41
One Letter Code DVSTPPTVLPDNFPRYPVGKFFQYDTWKQSTQRL
Molecular Formula C₁₈₇H₂₇₅N₄₇O₅₃
Relative Molecular Mass 4029.53
CAS Registry Number [315197-69-4] net
Source Synthetic
Storage Conditions -20 ± 5 °C