Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4058352
Return to Previous Page
4058352

Availability: In stock

RANTES (human) trifluoroacetate salt
H-Ser-Pro-Tyr-Ser-Ser-Asp-Thr-Thr-Pro-Cys-Cys-Phe-Ala-Tyr-Ile-Ala-Arg-Pro-Leu-Pro-Arg-Ala-His-Ile-Lys-Glu-Tyr-Phe-Tyr-Thr-Ser-Gly-Lys-Cys-Ser-Asn-Pro-Ala-Val-Val-Phe-Val-Thr-Arg-Lys-Asn-Arg-Gln-Val-Cys-Ala-Asn-Pro-Glu-Lys-Lys-Trp-Val-Arg-Glu-Tyr-Ile-Asn-Ser-Leu-Glu-Met-Ser-OH trifluoroacetate salt
(Disulfide bonds between Cys¹⁰ and Cys³⁴/Cys¹¹ and Cys⁵⁰)

4058352

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4058352.0050 50 µg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 378.00
CHF 351.54 (7%)
4058352.1000 1 mg Ships within 3-5 business days  
CHF 3,152.00
CHF 2,931.36 (7%)
Add to Wish List
Add to Compare

Details

Synthetic product. RANTES is a CC-chemokine that can signal via the CCR1, CCR3, CCR5 and US28 (cytomegalovirus receptor) receptors. It is chemotactic for T-cells, human eosinophils and basophils and plays an active role in recruiting leukocytes into inflammatory sites. RANTES also has the capability to inhibit certain strains of HIV-1, HIV-2 and simian immunodeficiency virus (SIV).
Catalog Number H-6542
One Letter Code SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
Synonyms Small-Inducible Cytokine A5, CCL5, T Cell-Specific Protein P228, TCP228
Molecular Formula C₃₅₀H₅₃₄N₉₆O₁₀₀S₅
Relative Molecular Mass 7847.01
CAS Registry Number [1927910-48-2] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Cytokines/Chemokines & their Receptors
Infectious Disease
Regenerative Medicine
Virology
Links / Documents:
Brochures:
No brochures found.

Product citations

J.A.Levy, J. Immunol., 182, 3945 (2009)