×

Cookie Settings

We use cookies so that we can offer you the best possible website experience. This includes cookies which are necessary for the operations of the website, as well as cookies that are only used for anonymous statistical purposes, for comfort settings or to display personalized content. Please note that based on your settings, it is possible that not all functionalities of the website will be available. You can find further information in our privacy policy.

Please make your personal preference here:

Imprint

 
 
Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4054476
Return to Previous Page
New!
4054476

Availability: In stock

(D-Ala²)-Gastric Inhibitory Polypeptide (human) trifluoroacetate salt
H-Tyr-D-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln-OH trifluoroacetate salt

4054476

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4054476.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 102.00
CHF 94.86 (7%)

Details

GIP receptor agonist.
Catalog Number H-7586
APC Number 46-1-67
One Letter Code YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
Synonyms [DAla2] Gastric Inhibitory Peptide (GIP), human, (D-Ala²)-GIP (human)
Molecular Formula C₂₂₆H₃₃₈N₆₀O₆₆S
Relative Molecular Mass 4983.53
CAS Registry Number 444073-04-5
Source Synthetic
Storage Conditions -20 ± 5 °C
Application Diabetes
Links / Documents:

Product citations

A.M.Duffy and C.Hölscher, Neuroscience, 228, 294 (2013)
E.Faivre et al., Eur. J. Pharmacol., 674, 294 (2012)
S.A.Hinke et al., Diabetes, 51, 652 (2002)