(D-Ala²)-Gastric Inhibitory Polypeptide (human) 4054476 | Bachem https://shop.bachem.com/4054476.html

Return to Previous Page

Promobanner OCT 2020

Availability: In stock

(D-Ala²)-Gastric Inhibitory Polypeptide (human) trifluoroacetate salt
H-Tyr-D-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln-OH trifluoroacetate salt

Product No.	Pack Size	Available	ADS InfoAnalytical Data Sheet	List Price	Online Order Price	Qty
4054476.0500	0.5 mg	Ships within 1 business day	ADSExemplary Data Sheet of a current available lot.	CHF 102.00	CHF 94.86 (7%)

GIP receptor agonist.

Catalog Number H-7586

APC Number 46-1-67

One Letter Code YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ

Synonyms [DAla2] Gastric Inhibitory Peptide (GIP), human, (D-Ala²)-GIP (human)

Molecular Formula C₂₂₆H₃₃₈N₆₀O₆₆S

Relative Molecular Mass 4983.53

CAS Registry Number 444073-04-5

Source Synthetic

Storage Conditions -20 ± 5 °C

Application Diabetes

Links / Documents: