Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Promobanner OCT 2020

Availability: In stock

4054142

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4054142.0050 50 µg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 420.00
CHF 390.60 (7%)
Catalog Number H-6474
One Letter Code VPIDVDKTKVHNTEPVENARIEPPDTGLYYDEYLKQVIEVLETDPHFREKLQKADIEEIRSGRLSQELDLVSHKVRTRLDEL
Synonyms NUCB2 (25-106) (mouse), Nucleobindin-2 (25-106) (mouse), DNA-Binding Protein NEFA (25-106) (mouse)
Molecular Formula C₄₂₄H₆₈₃N₁₁₇O₁₃₇
Relative Molecular Mass 9611.79
CAS Registry Number 917528-36-0
Source Synthetic
Storage Conditions -20 ± 5 °C
Keywords Anorexigenic peptide