Nesfatin-1 (rat) 4054141

Return to Previous Page

Availability: In stock

Nesfatin-1 (rat) trifluoroacetate salt
H-Val-Pro-Ile-Asp-Val-Asp-Lys-Thr-Lys-Val-His-Asn-Val-Glu-Pro-Val-Glu-Ser-Ala-Arg-Ile-Glu-Pro-Pro-Asp-Thr-Gly-Leu-Tyr-Tyr-Asp-Glu-Tyr-Leu-Lys-Gln-Val-Ile-Glu-Val-Leu-Glu-Thr-Asp-Pro-His-Phe-Arg-Glu-Lys-Leu-Gln-Lys-Ala-Asp-Ile-Glu-Glu-Ile-Arg-Ser-Gly-Arg-Leu-Ser-Gln-Glu-Leu-Asp-Leu-Val-Ser-His-Lys-Val-Arg-Thr-Arg-Leu-Asp-Glu-Leu-OH trifluoroacetate salt

Product No.	Pack Size	Available	ADS InfoAnalytical Data Sheet	Unit Price	Online Order Price	Qty
4054141.0050	50 µg	Ships within 1 business day	ADSExemplary Data Sheet of a current available lot.	CHF 420.00	CHF 390.60 (7%)
4054141.0250	250 µg	Ships within 3-5 business days		CHF 1,681.00	CHF 1,563.33 (7%)

Add to Wish List

Add to Compare

Catalog Number H-6472

One Letter Code VPIDVDKTKVHNVEPVESARIEPPDTGLYYDEYLKQVIEVLETDPHFREKLQKADIEEIRSGRLSQELDLVSHKVRTRLDEL

Synonyms Nucleobindin-2 (1-82) (rat), NUCB2 (1-82) (rat), DNA-Binding Protein NEFA (1-82) (rat)

Molecular Formula C₄₂₄H₆₈₄N₁₁₆O₁₃₆

Relative Molecular Mass 9582.80

CAS Registry Number [917528-37-1] net

Source Synthetic

Storage Conditions -20 ± 5 °C

Keywords Anorexigenic peptide

Areas of Interest Obesity Research
Pituitary & Hypothalamic Hormones

Links / Documents:

Brochures:

No brochures found.