×

Cookie Settings

We use cookies so that we can offer you the best possible website experience. This includes cookies which are necessary for the operations of the website, as well as cookies that are only used for anonymous statistical purposes, for comfort settings or to display personalized content. Please note that based on your settings, it is possible that not all functionalities of the website will be available. You can find further information in our privacy policy.

Please make your personal preference here:

Imprint

 
 
Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4054141
Return to Previous Page
4054141

Availability: In stock

Nesfatin-1 (rat) trifluoroacetate salt
H-Val-Pro-Ile-Asp-Val-Asp-Lys-Thr-Lys-Val-His-Asn-Val-Glu-Pro-Val-Glu-Ser-Ala-Arg-Ile-Glu-Pro-Pro-Asp-Thr-Gly-Leu-Tyr-Tyr-Asp-Glu-Tyr-Leu-Lys-Gln-Val-Ile-Glu-Val-Leu-Glu-Thr-Asp-Pro-His-Phe-Arg-Glu-Lys-Leu-Gln-Lys-Ala-Asp-Ile-Glu-Glu-Ile-Arg-Ser-Gly-Arg-Leu-Ser-Gln-Glu-Leu-Asp-Leu-Val-Ser-His-Lys-Val-Arg-Thr-Arg-Leu-Asp-Glu-Leu-OH trifluoroacetate salt

4054141

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4054141.0050 50 µg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 420.00
CHF 390.60 (7%)
Catalog Number H-6472
One Letter Code VPIDVDKTKVHNVEPVESARIEPPDTGLYYDEYLKQVIEVLETDPHFREKLQKADIEEIRSGRLSQELDLVSHKVRTRLDEL
Synonyms NUCB2 (1-82) (rat), Nucleobindin-2 (1-82) (rat), DNA-Binding Protein NEFA (1-82) (rat)
Molecular Formula C₄₂₄H₆₈₄N₁₁₆O₁₃₆
Relative Molecular Mass 9582.80
CAS Registry Number 917528-37-1
Source Synthetic
Storage Conditions -20 ± 5 °C
Keywords Anorexigenic peptide
Application Obesity Research
Pituitary & Hypothalamic Hormones
Links / Documents:

Product citations

I.S.Oh et al., Nature, 443, 709 (2006)
M.G.Myers, Jr., Nat. Med., 12, 1248 (2006)