×

Cookie Settings

We use cookies so that we can offer you the best possible website experience. This includes cookies which are necessary for the operations of the website, as well as cookies that are only used for anonymous statistical purposes, for comfort settings or to display personalized content. Please note that based on your settings, it is possible that not all functionalities of the website will be available. You can find further information in our privacy policy.

Please make your personal preference here:

Imprint

 
 
Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4051448
Return to Previous Page
4051448

Availability: In stock

SDF-1β (human) trifluoroacetate salt
H-Lys-Pro-Val-Ser-Leu-Ser-Tyr-Arg-Cys-Pro-Cys-Arg-Phe-Phe-Glu-Ser-His-Val-Ala-Arg-Ala-Asn-Val-Lys-His-Leu-Lys-Ile-Leu-Asn-Thr-Pro-Asn-Cys-Ala-Leu-Gln-Ile-Val-Ala-Arg-Leu-Lys-Asn-Asn-Asn-Arg-Gln-Val-Cys-Ile-Asp-Pro-Lys-Leu-Lys-Trp-Ile-Gln-Glu-Tyr-Leu-Glu-Lys-Ala-Leu-Asn-Lys-Arg-Phe-Lys-Met-OH trifluoroacetate salt (Disulfide bonds between Cys⁹ and Cys³⁴/Cys¹¹ and Cys⁵⁰)

4051448

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4051448.0010 10 µg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 189.00
CHF 175.77 (7%)

Details

Synthetically produced, contains BSA (low levels of endotoxins) in a ratio of 1:50. CXC chemokine that signals through the CXCR4 receptor and plays critical roles in migration, proliferation and differentiation of leukocytes. Since SDF-1 is involved in several problematic diseases such as AIDS, cancer cell metastasis, leukemia cell progression, rheumatoid arthritis and pulmonary fibrosis CXCR4 represents a therapeutic target for these conditions.
Catalog Number H-6392
One Letter Code KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM
Synonyms Stromal Cell-Derived Factor-1β (human)
Molecular Formula C₃₈₂H₆₂₀N₁₁₄O₉₇S₅
Relative Molecular Mass 8522.17
CAS Registry Number 1927911-05-4
Source Synthetic
Storage Conditions -20 ± 5 °C
Application Cancer Research
Infectious Disease
Regenerative Medicine
Links / Documents:

Product citations

H.Tamamura et al., Mini Rev. Med. Chem., 6, 989 (2006)
M.De La Luz Sierra et al., Blood, 103, 2452 (2004)
A.Müller et al., Nature, 410, 50 (2001)