×

Cookie Settings

We use cookies so that we can offer you the best possible website experience. This includes cookies which are necessary for the operations of the website, as well as cookies that are only used for anonymous statistical purposes, for comfort settings or to display personalized content. Please note that based on your settings, it is possible that not all functionalities of the website will be available. You can find further information in our privacy policy.

Please make your personal preference here:

Imprint

 
 
Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4050901
Return to Previous Page
4050901

Availability: In stock

(Gln⁹)-Amyloid β-Protein (1-40) trifluoroacetate salt
H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gln-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH trifluoroacetate salt

4050901

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4050901.0500 0.5 mg Ships within 3-5 business days  
CHF 79.00
CHF 73.47 (7%)
Catalog Number H-6434
One Letter Code DAEFRHDSQYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Synonyms Amyloid β-Protein (1-40) G9Q
Molecular Formula C₁₉₇H₃₀₀N₅₄O₅₉S
Relative Molecular Mass 4400.94
CAS Registry Number 1802084-59-8
Source Synthetic
Storage Conditions -20 ± 5 °C
Application Alzheimer's Disease
Links / Documents:
Brochures: