C5a Anaphylatoxin (human) 4050444 | Bachem https://shop.bachem.com/4050444.html

Return to Previous Page

Availability: In stock

C5a Anaphylatoxin (human) trifluoroacetate salt
H-Thr-Leu-Gln-Lys-Lys-Ile-Glu-Glu-Ile-Ala-Ala-Lys-Tyr-Lys-His-Ser-Val-Val-Lys-Lys-Cys-Cys-Tyr-Asp-Gly-Ala-Cys-Val-Asn-Asn-Asp-Glu-Thr-Cys-Glu-Gln-Arg-Ala-Ala-Arg-Ile-Ser-Leu-Gly-Pro-Arg-Cys-Ile-Lys-Ala-Phe-Thr-Glu-Cys-Cys-Val-Val-Ala-Ser-Gln-Leu-Arg-Ala-Asn-Ile-Ser-His-Lys-Asp-Met-Gln-Leu-Gly-Arg-OH trifluoroacetate salt (Disulfide bonds between Cys²¹ and Cys⁴⁷/Cys²² and Cys⁵⁴/Cys³⁴ and Cys⁵⁵)

4050444

Product No.	Pack Size	Available	ADS InfoAnalytical Data Sheet	List Price	Online Order Price	Qty
4050444.0100	0.1 mg	Ships within 1 business day	ADSExemplary Data Sheet of a current available lot.	CHF 510.00	CHF 474.30 (7%)

Details

Complement 5a plays a central role in host defenses and is implicated in functions associated with sepsis, adult respiratory distress syndrome, rheumatoid arthritis, psoriasis, neurodegeneration, and ischaemia/reperfusion injury. The molecule has potent chemoattractant and pro-inflammatory properties.

Catalog Number H-6322

One Letter Code TLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISLGPRCIKAFTECCVVASQLRANISHKDMQLGR

Molecular Formula C₃₅₀H₅₇₈N₁₀₈O₁₀₇S₈

Relative Molecular Mass 8267.63

CAS Registry Number 1816940-05-2

Source Synthetic

Storage Conditions -20 ± 5 °C

Keywords Pro-inflammatory peptide

Application Inflammation Research

Links / Documents: