×

Cookie Settings

We use cookies so that we can offer you the best possible website experience. This includes cookies which are necessary for the operations of the website, as well as cookies that are only used for anonymous statistical purposes, for comfort settings or to display personalized content. Please note that based on your settings, it is possible that not all functionalities of the website will be available. You can find further information in our privacy policy.

Please make your personal preference here:

Imprint

 
 
Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4050444
Return to Previous Page
4050444

Availability: In stock

C5a Anaphylatoxin (human) trifluoroacetate salt
H-Thr-Leu-Gln-Lys-Lys-Ile-Glu-Glu-Ile-Ala-Ala-Lys-Tyr-Lys-His-Ser-Val-Val-Lys-Lys-Cys-Cys-Tyr-Asp-Gly-Ala-Cys-Val-Asn-Asn-Asp-Glu-Thr-Cys-Glu-Gln-Arg-Ala-Ala-Arg-Ile-Ser-Leu-Gly-Pro-Arg-Cys-Ile-Lys-Ala-Phe-Thr-Glu-Cys-Cys-Val-Val-Ala-Ser-Gln-Leu-Arg-Ala-Asn-Ile-Ser-His-Lys-Asp-Met-Gln-Leu-Gly-Arg-OH trifluoroacetate salt (Disulfide bonds between Cys²¹ and Cys⁴⁷/Cys²² and Cys⁵⁴/Cys³⁴ and Cys⁵⁵)

4050444

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4050444.0100 0.1 mg Ships within 3-5 business days  
CHF 510.00
CHF 474.30 (7%)

Details

Complement 5a plays a central role in host defenses and is implicated in functions associated with sepsis, adult respiratory distress syndrome, rheumatoid arthritis, psoriasis, neurodegeneration, and ischaemia/reperfusion injury. The molecule has potent chemoattractant and pro-inflammatory properties.
Catalog Number H-6322
One Letter Code TLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISLGPRCIKAFTECCVVASQLRANISHKDMQLGR
Molecular Formula C₃₅₀H₅₇₈N₁₀₈O₁₀₇S₈
Relative Molecular Mass 8267.63
CAS Registry Number 1816940-05-2
Source Synthetic
Storage Conditions -20 ± 5 °C
Keywords Pro-inflammatory peptide
Application Inflammation Research
Links / Documents:

Bachem product citations

E.T.Berends et al., BMC Biol., 13, 93 (2015)
E.T.Berends et al., Cell Microbiol., 15, 1955 (2013)

Product citations

P.N.Monk et al., Br. J. Pharmacol., 152, 429 (2007)
R.F.Guo and P.A.Ward, Annu. Rev. Immunol., 23, 821 (2005)