×

Cookie Settings

We use cookies so that we can offer you the best possible website experience. This includes cookies which are necessary for the operations of the website, as well as cookies that are only used for anonymous statistical purposes, for comfort settings or to display personalized content. Please note that based on your settings, it is possible that not all functionalities of the website will be available. You can find further information in our privacy policy.

Please make your personal preference here:

Imprint

 
 
Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4046855
Return to Previous Page
4046855

Availability: In stock

LL-37 amide trifluoroacetate salt
H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-NH₂ trifluoroacetate salt

4046855

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4046855.0001 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 408.00
CHF 379.44 (7%)
4046855.0005 5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 1,224.00
CHF 1,138.32 (7%)

Details

LL-37 amide is an antimicrobial peptide with angiogenic activity.
Catalog Number H-6224
One Letter Code LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-NH₂
Synonyms LL37, Antibacterial Protein LL-37 amide (human), CAMP
Molecular Formula C₂₀₅H₃₄₁N₆₁O₅₂
Relative Molecular Mass 4492.34
CAS Registry Number 597562-32-8
Source Synthetic
Storage Conditions -20 ± 5 °C
Application Angiogenesis
Antimicrobial & Antiviral Peptides
Links / Documents:
Brochures:

Bachem product citations

D.Svensson et al., Biochem. Biophys. Res. Commun., 493, 71 (2017)
D.Svensson et al., J. Periodontal Res., 50, 80 (2015)
H.Choi et al., PLoS One, 9, e104500 (2014)
S.Dosler and E.Karaaslan, Peptides, 62, 32 (2014)
J.Sall et al., J. Innate Immun., 5, 290 (2013)
R.Ramos et al., Peptides, 32, 1469 (2011)
K.A.Sochacki et al., Proc. Natl. Acad. Sci. USA, 108, E77 (2001)

Product citations

D.Vandamme et al., Cell. Immunol., 280, 22 (2012)
T.Tecle et al., Innate Immun., 16, 151 (2010)
F.Neville et al., Biophys. J., 90, 1275 (2006)
U.H.Dürr et al., Biochim. Biophys. Acta, 1758, 1408 (2006)
S.Sandgren et al., J. Biol. Chem., 279, 17951 (2004)
Related products