Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4046855
Return to Previous Page
4046855

Availability: In stock

LL-37 amide trifluoroacetate salt
H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-NH₂ trifluoroacetate salt

4046855

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4046855.0001 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 408.00
CHF 379.44 (7%)
4046855.0005 5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 1,224.00
CHF 1,138.32 (7%)
Add to Wish List
Add to Compare

Details

LL-37 amide is an antimicrobial peptide with angiogenic activity.
Catalog Number H-6224
One Letter Code LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-NH₂
Synonyms Antibacterial Protein LL-37 amide (human), LL37, CAMP
Molecular Formula C₂₀₅H₃₄₁N₆₁O₅₂
Relative Molecular Mass 4492.34
CAS Registry Number [597562-32-8] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Angiogenesis
Antimicrobial & Antiviral Peptides
Links / Documents:
Brochures:

Bachem product citations

D.Svensson et al., J. Periodontal Res., 50, 80 (2015)
J.Sall et al., J. Innate Immun., 5, 290 (2013)
R.Ramos et al., Peptides, 32, 1469 (2011)
K.A.Sochacki et al., Proc. Natl. Acad. Sci. USA, 108, E77 (2001)

Product citations

D.Vandamme et al., Cell. Immunol., 280, 22 (2012)
T.Tecle et al., Innate Immun., 16, 151 (2010)
U.H.Dürr et al., Biochim. Biophys. Acta, 1758, 1408 (2006)
F.Neville et al., Biophys. J., 90, 1275 (2006)
S.Sandgren et al., J. Biol. Chem., 279, 17951 (2004)
Related products