×

Cookie Settings

We use cookies so that we can offer you the best possible website experience. This includes cookies which are necessary for the operations of the website, as well as cookies that are only used for anonymous statistical purposes, for comfort settings or to display personalized content. Please note that based on your settings, it is possible that not all functionalities of the website will be available. You can find further information in our privacy policy.

Please make your personal preference here:

Imprint

 
 
Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4046796
Return to Previous Page
New!
4046796

Availability: In stock

Amyloid β-Protein (3-40) trifluoroacetate salt
H-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH trifluoroacetate salt

4046796

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4046796.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 133.00
CHF 123.69 (7%)
4046796.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 240.00
CHF 223.20 (7%)
Catalog Number H-7672
APC Number 62-0-99
One Letter Code EFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Synonyms β-Amyloid (3-40)
Molecular Formula C₁₈₇H₂₈₅N₅₁O₅₄S
Relative Molecular Mass 4143.70
CAS Registry Number 157884-70-3
Source Synthetic
Storage Conditions -20 ± 5 °C
Application Alzheimer's Disease
Links / Documents:
Brochures: