Oxyntomodulin (human, mouse, rat) 4044527

Return to Previous Page

Availability: In stock

Oxyntomodulin (human, mouse, rat) trifluoroacetate salt
H-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-Lys-Arg-Asn-Arg-Asn-Asn-Ile-Ala-OH trifluoroacetate salt

4044527

Product No.	Pack Size	Available	ADS InfoAnalytical Data Sheet	List Price	Online Order Price	Qty
4044527.0500	0.5 mg	Ships within 1 business day	ADSExemplary Data Sheet of a current available lot.	CHF 630.00	CHF 585.90 (7%)
4044527.1000	1 mg	Ships within 1 business day	ADSExemplary Data Sheet of a current available lot.	CHF 1,156.00	CHF 1,075.08 (7%)

Details

Oxyntomodulin potently inhibits gastric acid secretion and pancreatic enzyme secretion when infused iv. Moreover, it was shown that intracerebroventricularly and into the hypothalamic paraventricular nucleus injected oxyntomodulin inhibits food intake in fasted and nonfasted animals potently and in a sustained manner.

Catalog Number H-6058

APC Number 46-1-46

One Letter Code HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA

Synonyms Glucagon-37 (human, mouse, rat), OXM (human, mouse, rat), Preproglucagon (53-89) (human, mouse, rat), Proglucagon (33-69) (human, mouse, rat)

Molecular Formula C₁₉₂H₂₉₅N₆₁O₆₀S

Relative Molecular Mass 4449.90

CAS Registry Number [159002-68-3] net

Source Synthetic

Storage Conditions -20 ± 5 °C

Areas of Interest Diabetes
Veterinary Medicine

Links / Documents:

Brochures: