Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

BNP-32 (rat) trifluoroacetate salt
H-Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala-Val-Ser-Arg-Leu-Gly-Cys-Asp-Gly-Leu-Arg-Leu-Phe-OH trifluoroacetate salt (Disulfide bond)

4043015

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4043015.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 494.00
CHF 459.42 (7%)
4043015.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 882.00
CHF 820.26 (7%)
Catalog Number H-5968
APC Number 14-5-11
One Letter Code NSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF
Synonyms Brain Natriuretic Peptide-32 (rat), BNP (1-32), rat
Molecular Formula C₁₄₆H₂₃₉N₄₇O₄₄S₃
Relative Molecular Mass 3452.99
CAS Registry Number 133448-20-1
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Regenerative Medicine