BNP-32 (rat) 4043015

Return to Previous Page

Availability: In stock

BNP-32 (rat) trifluoroacetate salt
H-Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala-Val-Ser-Arg-Leu-Gly-Cys-Asp-Gly-Leu-Arg-Leu-Phe-OH trifluoroacetate salt
(Disulfide bond)

Product No.	Pack Size	Available	ADS InfoAnalytical Data Sheet	List Price	Online Order Price	Qty
4043015.0500	0.5 mg	Ships within 1 business day	ADSExemplary Data Sheet of a current available lot.	CHF 494.00	CHF 459.42 (7%)
4043015.1000	1 mg	Ships within 1 business day	ADSExemplary Data Sheet of a current available lot.	CHF 882.00	CHF 820.26 (7%)

Catalog Number H-5968

APC Number 14-5-11

One Letter Code NSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF

Synonyms Brain Natriuretic Peptide-32 (rat), BNP (1-32), rat

Molecular Formula C₁₄₆H₂₃₉N₄₇O₄₄S₃

Relative Molecular Mass 3452.99

CAS Registry Number [133448-20-1] net

Source Synthetic

Storage Conditions -20 ± 5 °C

Areas of Interest Regenerative Medicine

Links / Documents:

Brochures:

No brochures found.