×

Cookie Settings

We use cookies so that we can offer you the best possible website experience. This includes cookies which are necessary for the operations of the website, as well as cookies that are only used for anonymous statistical purposes, for comfort settings or to display personalized content. Please note that based on your settings, it is possible that not all functionalities of the website will be available. You can find further information in our privacy policy.

Please make your personal preference here:

Imprint

 
 
Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4043015
Return to Previous Page
4043015

Availability: In stock

BNP-32 (rat) trifluoroacetate salt
H-Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala-Val-Ser-Arg-Leu-Gly-Cys-Asp-Gly-Leu-Arg-Leu-Phe-OH trifluoroacetate salt (Disulfide bond)

4043015

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4043015.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 494.00
CHF 459.42 (7%)
4043015.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 882.00
CHF 820.26 (7%)
Catalog Number H-5968
APC Number 14-5-11
One Letter Code NSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF
Synonyms Brain Natriuretic Peptide-32 (rat), BNP (1-32), rat
Molecular Formula C₁₄₆H₂₃₉N₄₇O₄₄S₃
Relative Molecular Mass 3452.99
CAS Registry Number 133448-20-1
Source Synthetic
Storage Conditions -20 ± 5 °C
Application Regenerative Medicine
Links / Documents:

Product citations

A.C.Rosenkranz, Diabetes, 52, 2389 (2003)
M.Kojima et al., Biochem. Biophys. Res. Commun., 159, 1420 (1989)