×

Cookie Settings

We use cookies so that we can offer you the best possible website experience. This includes cookies which are necessary for the operations of the website, as well as cookies that are only used for anonymous statistical purposes, for comfort settings or to display personalized content. Please note that based on your settings, it is possible that not all functionalities of the website will be available. You can find further information in our privacy policy.

Please make your personal preference here:

Imprint

 
 
Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4040190
Return to Previous Page
4040190

Availability: In stock

GLP-1 (7-36) amide (chicken, common turkey) trifluoroacetate salt
H-His-Ala-Glu-Gly-Thr-Tyr-Thr-Ser-Asp-Ile-Thr-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Asn-Gly-Arg-NH₂ trifluoroacetate salt

4040190

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4040190.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 263.00
CHF 244.59 (7%)
Catalog Number H-5824
APC Number 46-0-90
One Letter Code HAEGTYTSDITSYLEGQAAKEFIAWLVNGR-NH₂
Synonyms Glucagon-Like Peptide 1 (7-36) amide (chicken, common turkey), Preproglucagon (118-147) amide (chicken, common turkey), Proglucagon (96-125) amide (chicken, common turkey)
Molecular Formula C₁₄₉H₂₂₄N₄₀O₄₇
Relative Molecular Mass 3327.66
CAS Registry Number 1802078-26-7
Source Synthetic
Storage Conditions -20 ± 5 °C
Application Diabetes
Links / Documents:
Brochures:

Bachem product citations

K.A.Vessey et al., Invest. Ophthalmol. Vis. Sci., 46, 3932 (2005)