Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4040190
Return to Previous Page
4040190

Availability: In stock

GLP-1 (7-36) amide (chicken, common turkey) trifluoroacetate salt
H-His-Ala-Glu-Gly-Thr-Tyr-Thr-Ser-Asp-Ile-Thr-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Asn-Gly-Arg-NH₂ trifluoroacetate salt

4040190

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4040190.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 263.00
CHF 244.59 (7%)
4040190.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 473.00
CHF 439.89 (7%)
Catalog Number H-5824
APC Number 46-0-90
One Letter Code HAEGTYTSDITSYLEGQAAKEFIAWLVNGR-NH₂
Synonyms Glucagon-Like Peptide 1 (7-36) amide (chicken, common turkey), Preproglucagon (118-147) amide (chicken, common turkey), Proglucagon (96-125) amide (chicken, common turkey)
Molecular Formula C₁₄₉H₂₂₄N₄₀O₄₇
Relative Molecular Mass 3327.66
CAS Registry Number 1802078-26-7
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Diabetes
Links / Documents:
Brochures:

Bachem product citations

K.A.Vessey et al., Invest. Ophthalmol. Vis. Sci., 46, 3932 (2005)