Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

(Ala¹¹·²²·²⁸)-VIP (human, mouse, rat) trifluoroacetate salt
H-His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Ala-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Ala-Leu-Asn-Ser-Ile-Leu-Ala-NH₂ trifluoroacetate salt

4040136

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4040136.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 242.00
CHF 225.06 (7%)
4040136.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 436.00
CHF 405.48 (7%)
Add to Wish List
Add to Compare

Details

Highly selective human VPAC1 receptor agonist. It showed a 1000-fold higher efficiency in stimulating adenylate cyclase activity from VPAC1 than from VPAC2 receptors and therefore represents an effective pharmacological tool to characterize VPAC1 receptor-mediated events.
Catalog Number H-5802
One Letter Code HSDAVFTDNYARLRKQMAVKKALNSILA-NH₂
Synonyms (Ala¹¹·²²·²⁸)-Aviptadil
Molecular Formula C₁₃₉H₂₃₁N₄₃O₃₉S
Relative Molecular Mass 3160.70
CAS Registry Number [291524-04-4] net
Source Synthetic
Storage Conditions -20 ± 5 °C