×

Cookie Settings

We use cookies so that we can offer you the best possible website experience. This includes cookies which are necessary for the operations of the website, as well as cookies that are only used for anonymous statistical purposes, for comfort settings or to display personalized content. Please note that based on your settings, it is possible that not all functionalities of the website will be available. You can find further information in our privacy policy.

Please make your personal preference here:

Imprint

 
 
Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4040136
Return to Previous Page
4040136

Availability: In stock

(Ala¹¹·²²·²⁸)-VIP (human, mouse, rat) trifluoroacetate salt
H-His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Ala-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Ala-Leu-Asn-Ser-Ile-Leu-Ala-NH₂ trifluoroacetate salt

4040136

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4040136.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 242.00
CHF 225.06 (7%)
4040136.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 436.00
CHF 405.48 (7%)

Details

Highly selective human VPAC1 receptor agonist. It showed a 1000-fold higher efficiency in stimulating adenylate cyclase activity from VPAC1 than from VPAC2 receptors and therefore represents an effective pharmacological tool to characterize VPAC1 receptor-mediated events.
Catalog Number H-5802
One Letter Code HSDAVFTDNYARLRKQMAVKKALNSILA-NH₂
Synonyms (Ala¹¹·²²·²⁸)-Aviptadil
Molecular Formula C₁₃₉H₂₃₁N₄₃O₃₉S
Relative Molecular Mass 3160.70
CAS Registry Number 291524-04-4
Source Synthetic
Storage Conditions -20 ± 5 °C
Links / Documents:
Brochures:

Bachem product citations

Q.Li et al., Am. J. Physiol. Gastrointest. Liver Physiol., 305, G503 (2013)
Y.Sheikine et al., Biochem. Biophys. Res. Commun., 402, 471 (2010)
M.C.Grimm et al., J. Immunol., 171, 4990 (2003)

Product citations

P.Nicole et al., J. Biol. Chem., 275, 24003 (2000)