Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

(Asn²³)-Amyloid β-Protein (1-40)
H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asn-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH

4039929

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4039929.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 154.00
CHF 143.22 (7%)
4039929.1000 1 mg Ships within 3-5 business days  
CHF 256.00
CHF 238.08 (7%)

Details

The Iowa (D23N) mutant of Aβ 40 considerably more rapidly assembles in solution to form fibrils than the WT Aβ sequence. These fibrils also show a different structure, which could be responsible for their increased toxicity.
Catalog Number H-7332
One Letter Code DAEFRHDSGYEVHHQKLVFFAENVGSNKGAIIGLMVGGVV
Synonyms Amyloid β-Protein (1-40) Iowa Mutation, Amyloid β-Protein (1-40) D23N, Abeta (1-40) D23N
Molecular Formula C₁₉₄H₂₉₆N₅₄O₅₇S
Relative Molecular Mass 4328.88
CAS Registry Number [374796-72-2]
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Alzheimer's Disease