GLP-2 (1-33) (human) 4039611

Return to Previous Page

Availability: In stock

GLP-2 (1-33) (human) trifluoroacetate salt
H-His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-OH trifluoroacetate salt

4039611

Product No.	Pack Size	Available	ADS InfoAnalytical Data Sheet	List Price	Online Order Price	Qty
4039611.0500	0.5 mg	Ships within 1 business day	ADSExemplary Data Sheet of a current available lot.	CHF 210.00	CHF 195.30 (7%)
4039611.1000	1 mg	Ships within 1 business day	ADSExemplary Data Sheet of a current available lot.	CHF 378.00	CHF 351.54 (7%)

Details

Like GLP-1, GLP-2 is secreted from enteroendocrine cells in a nutrient-dependent manner in both rodents and humans. Currently GLP-2 is used as a potential therapeutic agent for human subjects with a broad variety of intestinal diseases characterized by intestinal damage and insufficiency.

Catalog Number H-5662

One Letter Code HADGSFSDEMNTILDNLAARDFINWLIQTKITD

Synonyms Glucagon-Like Peptide 2 (human), Preproglucagon (146-178) (human), Proglucagon (126-158) (human)

Molecular Formula C₁₆₅H₂₅₄N₄₄O₅₅S

Relative Molecular Mass 3766.16

CAS Registry Number [223460-79-5] net

Source Synthetic

Storage Conditions -20 ± 5 °C

Areas of Interest Diabetes

Links / Documents:

Brochures: