×

Cookie Settings

We use cookies so that we can offer you the best possible website experience. This includes cookies which are necessary for the operations of the website, as well as cookies that are only used for anonymous statistical purposes, for comfort settings or to display personalized content. Please note that based on your settings, it is possible that not all functionalities of the website will be available. You can find further information in our privacy policy.

Please make your personal preference here:

Imprint

 
 
Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4039298
Return to Previous Page
4039298

Availability: In stock

(Tyr⁰)-BNP-32 (human) trifluoroacetate salt
H-Tyr-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH trifluoroacetate salt (Disulfide bond)

4039298

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4039298.0500 0.5 mg Ships within 3-5 business days  
CHF 473.00
CHF 439.89 (7%)
Catalog Number H-5698
APC Number 14-1-91
One Letter Code YSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
Synonyms [Tyr0] BNP (1-32) human, (Tyr⁰)-Brain Natriuretic Peptide-32 (human)
Molecular Formula C₁₅₂H₂₅₃N₅₁O₄₄S₄
Relative Molecular Mass 3627.26
CAS Registry Number 1815617-97-0
Source Synthetic
Storage Conditions -20 ± 5 °C
Links / Documents: