×

Cookie Settings

We use cookies so that we can offer you the best possible website experience. This includes cookies which are necessary for the operations of the website, as well as cookies that are only used for anonymous statistical purposes, for comfort settings or to display personalized content. Please note that based on your settings, it is possible that not all functionalities of the website will be available. You can find further information in our privacy policy.

Please make your personal preference here:

Imprint

 
 
Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4038267
Return to Previous Page
4038267

Availability: In stock

Amyloid β-Protein (1-40) hydrochloride salt
H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH hydrochloride salt

4038267

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4038267.0100 0.1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 102.00
CHF 94.86 (7%)
4038267.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 221.00
CHF 205.53 (7%)
4038267.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 368.00
CHF 342.24 (7%)

Details

Compared to the TFA salt, the HCl salt of amyloid β-protein (1-40) easily forms β-structures in PBS within a few hours at 25°C. β-structure formation is essential for amyloid peptide toxicity.
Catalog Number H-5568
One Letter Code DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Synonyms Aβ40 hydrochloride salt
Molecular Formula C₁₉₄H₂₉₅N₅₃O₅₈S
Relative Molecular Mass 4329.86
CAS Registry Number 131438-79-4
Source Synthetic
Storage Conditions -20 ± 5 °C
Application Alzheimer's Disease
Links / Documents:
Brochures:

Bachem product citations

M.Lotz et al., J. Neurochem., 94, 289 (2005)

Product citations

I.Kaneko, J. Neurochem., 68, 438 (1997)
Related products