×

Cookie Settings

We use cookies so that we can offer you the best possible website experience. This includes cookies which are necessary for the operations of the website, as well as cookies that are only used for anonymous statistical purposes, for comfort settings or to display personalized content. Please note that based on your settings, it is possible that not all functionalities of the website will be available. You can find further information in our privacy policy.

Please make your personal preference here:

Imprint

 
 
Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4037473
Return to Previous Page
4037473

Availability: Out of stock

(Gly²⁸,Cys³⁰)-Amyloid β-Protein (1-30) amide trifluoroacetate salt
H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Gly-Gly-Cys-NH₂ trifluoroacetate salt

4037473

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price
4037473.0500 0.5 mg Request lead time  
CHF 105.00
CHF 97.65 (7%)
Catalog Number H-6386
One Letter Code DAEFRHDSGYEVHHQKLVFFAEDVGSNGGC-NH₂
Synonyms (Gly⁶⁹⁹,Cys⁷⁰¹)-APP₇₇₀ (672-701) amide, (Gly⁶⁹⁹,Cys⁷⁰¹)-Amyloid β/A4 Protein Precursor₇₇₀ (672-701) amide, Amyloid β-Protein (1-30) amide K28G/A30C
Molecular Formula C₁₄₆H₂₀₉N₄₃O₄₇S
Relative Molecular Mass 3350.59
CAS Registry Number 1802080-88-1
Source Synthetic
Storage Conditions -20 ± 5 °C
Application Alzheimer's Disease
Links / Documents:
Brochures: