Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Promobanner OCT 2020

Availability: In stock

(Gly²⁸,Cys³⁰)-Amyloid β-Protein (1-30) amide trifluoroacetate salt
H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Gly-Gly-Cys-NH₂ trifluoroacetate salt

4037473

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4037473.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 105.00
CHF 97.65 (7%)
Catalog Number H-6386
One Letter Code DAEFRHDSGYEVHHQKLVFFAEDVGSNGGC-NH₂
Synonyms (Gly⁶⁹⁹,Cys⁷⁰¹)-Amyloid β/A4 Protein Precursor₇₇₀ (672-701) amide, (Gly⁶⁹⁹,Cys⁷⁰¹)-APP₇₇₀ (672-701) amide, Amyloid β-Protein (1-30) amide K28G/A30C
Molecular Formula C₁₄₆H₂₀₉N₄₃O₄₇S
Relative Molecular Mass 3350.59
CAS Registry Number 1802080-88-1
Source Synthetic
Storage Conditions -20 ± 5 °C
Application Alzheimer's Disease