×

Cookie Settings

We use cookies so that we can offer you the best possible website experience. This includes cookies which are necessary for the operations of the website, as well as cookies that are only used for anonymous statistical purposes, for comfort settings or to display personalized content. Please note that based on your settings, it is possible that not all functionalities of the website will be available. You can find further information in our privacy policy.

Please make your personal preference here:

Imprint

 
 
Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4037472
Return to Previous Page
4037472

Availability: In stock

Cys-Gly-Lys-Arg-Amyloid β-Protein (1-42) trifluoroacetate salt
H-Cys-Gly-Lys-Arg-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH trifluoroacetate salt

4037472

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4037472.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 238.00
CHF 221.34 (7%)
4037472.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 421.00
CHF 391.53 (7%)
Catalog Number H-6388
One Letter Code CGKRDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Synonyms (Cys⁶⁶⁸,Gly⁶⁶⁹,Arg⁶⁷¹)-APP₇₇₀ (668-713), (Cys⁶⁶⁸,Gly⁶⁶⁹,Arg⁶⁷¹)-Amyloid β/A4 Protein Precursor₇₇₀ (668-713)
Molecular Formula C₂₂₀H₃₄₃N₆₃O₆₄S₂
Relative Molecular Mass 4958.66
CAS Registry Number 1802086-21-0
Source Synthetic
Storage Conditions -20 ± 5 °C
Application Alzheimer's Disease
Links / Documents:
Brochures: