×

Cookie Settings

We use cookies so that we can offer you the best possible website experience. This includes cookies which are necessary for the operations of the website, as well as cookies that are only used for anonymous statistical purposes, for comfort settings or to display personalized content. Please note that based on your settings, it is possible that not all functionalities of the website will be available. You can find further information in our privacy policy.

Please make your personal preference here:

Imprint

 
 
Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4036028
Return to Previous Page
New!
4036028

Availability: In stock

Amyloid β-Protein (2-42) trifluoroacetate salt
H-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH trifluoroacetate salt

4036028

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4036028.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 413.00
CHF 384.09 (7%)

Details

Aβ 2-42 could be a biomarker for differentiating AD from other degenerative dementias, such as frontotemporal dementias (FTD). The peptide promotes phagocytosis by macrophages.
Catalog Number H-7472
One Letter Code AEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Formula C₁₉₉H₃₀₆N₅₄O₅₇S
Relative Molecular Mass 4399.01
CAS Registry Number 1678416-22-2
Source Synthetic
Storage Conditions -20 ± 5 °C
Application Alzheimer's Disease
Links / Documents:
Brochures:

Product citations

M.Condic et al., Brain. Behav. Immun., 41, 116 (2014)
M.Bibl et al., J. Alzheimers Dis., 29, 809 (2012)
M.Bibl et al., J. Neural Transm., 119, 805 (2012)
J.Wiltfang et al., J. Biol. Chem., 276, 42645 (2001)