Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4034867
Return to Previous Page
4034867

Availability: In stock

(Cys⁰)-Amyloid β-Protein (1-40) trifluoroacetate salt
H-Cys-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH trifluoroacetate salt

4034867

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4034867.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 148.00
CHF 137.64 (7%)
4034867.1000 1 mg Ships within 3-5 business days  
CHF 262.00
CHF 243.66 (7%)
Add to Wish List
Add to Compare

Details

Cys-Aβ1-40 can be easily and selectively modified, labeled, coupled to carriers e.g. by maleimide chemistry without affecting the sequences involved in fibril formation. The free mercapto moiety of the peptide adheres to gold surfaces.
Catalog Number H-7368
APC Number 62-0-23
One Letter Code CDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Formula C₁₉₇H₃₀₀N₅₄O₅₉S₂
Relative Molecular Mass 4433.01
CAS Registry Number [208266-35-7] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Alzheimer's Disease
Links / Documents:
Brochures:

Product citations

B.-H.Kim et al., Biochemistry, 50, 5154 (2011)
A.Majzik et al., Colloids Surf. B, 81, 235 (2010)