Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4034845
Return to Previous Page
4034845

Availability: In stock

ACTH (1-39) (mouse, rat) trifluoroacetate salt
H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Val-Ala-Glu-Asn-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe-OH trifluoroacetate salt

4034845

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4034845.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 189.00
CHF 175.77 (7%)
4034845.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 315.00
CHF 292.95 (7%)
Add to Wish List
Add to Compare
Catalog Number H-4998
APC Number 10-1-15
One Letter Code SYSMEHFRWGKPVGKKRRPVKVYPNVAENESAEAFPLEF
Molecular Formula C₂₁₀H₃₁₅N₅₇O₅₇S
Relative Molecular Mass 4582.23
CAS Registry Number [77465-10-2] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Keywords Peptide hormone
Links / Documents:
Brochures:

Bachem product citations

N.Tennoune et al., Nutrition, 31, 498 (2015)
M.A.Steiner et al., Psychoneuroendocrinology, 38, 560 (2013)
N.Tsukiyama et al., Stress, 14, 368 (2011)
S.T.Hentges et al., J. Neurosci., 29, 13684 (2009)
G.Galietta et al., Eur. J. Pharmacol., 550, 180 (2006)

Product citations

J.Drouin et al., FEBS Lett., 193, 54 (1985)
E.Oates and E.Herbert, J. Biol. Chem., 259, 7421 (1984)
J.Drouin and H.M.Goodman, Nature, 288, 610 (1980)