×

Cookie Settings

We use cookies so that we can offer you the best possible website experience. This includes cookies which are necessary for the operations of the website, as well as cookies that are only used for anonymous statistical purposes, for comfort settings or to display personalized content. Please note that based on your settings, it is possible that not all functionalities of the website will be available. You can find further information in our privacy policy.

Please make your personal preference here:

Imprint

 
 
Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4034693
Return to Previous Page
New!
4034693

Availability: In stock

β-Defensin 2 (human) trifluoroacetate salt
H-Gly-Ile-Gly-Asp-Pro-Val-Thr-Cys-Leu-Lys-Ser-Gly-Ala-Ile-Cys-His-Pro-Val-Phe-Cys-Pro-Arg-Arg-Tyr-Lys-Gln-Ile-Gly-Thr-Cys-Gly-Leu-Pro-Gly-Thr-Lys-Cys-Cys-Lys-Lys-Pro-OH trifluoroacetate salt (Disulfide bonds, air oxidized)

4034693

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4034693.0100 0.1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 291.00
CHF 270.63 (7%)
4034693.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 1,005.00
CHF 934.65 (7%)

Details

Two β-defensins (hBD1 and hBD2) have been identified in humans. β-defensins are inducible, potent, and selectively killing mainly Gram-negative bacteria and yeast. In addition, β-defensins mobilize cells engaged in adaptive immune responses.
Catalog Number H-8256
One Letter Code GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP
Synonyms Skin-antimicrobial peptide 1 (human), β-Defensin 4A (human)
Molecular Formula C₁₈₈H₃₀₅N₅₅O₅₀S₆
Relative Molecular Mass 4328.23
Source Synthetic
Storage Conditions -20 ± 5 °C
Keywords Antimicrobial peptide
Application Antimicrobial & Antiviral Peptides
Links / Documents:
Brochures:

Product citations

D.M. Hoover et al., J. Biol. Chem., 42, 32911 (2000)