×

Cookie Settings

We use cookies so that we can offer you the best possible website experience. This includes cookies which are necessary for the operations of the website, as well as cookies that are only used for anonymous statistical purposes, for comfort settings or to display personalized content. Please note that based on your settings, it is possible that not all functionalities of the website will be available. You can find further information in our privacy policy.

Please make your personal preference here:

Imprint

 
 
Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4034653
Return to Previous Page
4034653

Availability: In stock

Gastric Inhibitory Polypeptide (3-42) (human) trifluoroacetate salt
H-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln-OH trifluoroacetate salt

4034653

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4034653.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 294.00
CHF 273.42 (7%)
4034653.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 525.00
CHF 488.25 (7%)

Details

Gastric inhibitory polypeptide (3-42) represents the major physiological degradation product of gastric inhibitory polypeptide (GIP). It is generated by proteolytic processing of GIP by dipeptidyl peptidase IV (DPP IV).
Catalog Number H-6614
One Letter Code EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
Synonyms GIP (3-42) (human), Glucose-Dependent Insulinotropic Polypeptide (3-42) (human)
Molecular Formula C₂₁₄H₃₂₄N₅₈O₆₃S
Relative Molecular Mass 4749.35
CAS Registry Number 1802086-25-4
Source Synthetic
Storage Conditions -20 ± 5 °C
Application Diabetes
Links / Documents:

Bachem product citations

A.Miyachi et al., J. Proteome Res., 12, 2690 (2013)

Product citations

V.A.Gault et al., J. Endocrinol., 175, 525 (2002)