×

Cookie Settings

We use cookies so that we can offer you the best possible website experience. This includes cookies which are necessary for the operations of the website, as well as cookies that are only used for anonymous statistical purposes, for comfort settings or to display personalized content. Please note that based on your settings, it is possible that not all functionalities of the website will be available. You can find further information in our privacy policy.

Please make your personal preference here:

Imprint

 
 
Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4031193
Return to Previous Page
4031193

Availability: In stock

(Tyr³⁶)-pTH-Related Protein (1-36) (human, mouse, rat)
H-Ala-Val-Ser-Glu-His-Gln-Leu-Leu-His-Asp-Lys-Gly-Lys-Ser-Ile-Gln-Asp-Leu-Arg-Arg-Arg-Phe-Phe-Leu-His-His-Leu-Ile-Ala-Glu-Ile-His-Thr-Ala-Glu-Tyr-OH

4031193

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4031193.0500 0.5 mg Ships within 3-5 business days  
CHF 473.00
CHF 439.89 (7%)
4031193.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 851.00
CHF 791.43 (7%)

Details

(Tyr³⁶)-pTHrP (1-36) has been used for radioiodination.
Catalog Number H-3208
One Letter Code AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEY
Synonyms (Tyr³⁶)-Hypercalcemia of Malignancy Factor (1-36) (human, mouse, rat)
Molecular Formula C₁₉₄H₃₀₃N₅₉O₅₃
Relative Molecular Mass 4309.91
CAS Registry Number 213779-11-4
Source Synthetic
Storage Conditions -20 ± 5 °C
Application Osteoporosis Research
Links / Documents:

Bachem product citations

E.Kozhemyakina et al., Mol. Cell. Biol., 29, 5751 (2009)
A.Ortega et al., J. Am. Soc. Nephrol., 17, 1594 (2006)
E.A.Blomme et al., J. Invest. Dermatol., 112, 788 (1999)
E.C.Weir et al., Proc. Natl. Acad. Sci. USA, 87, 108 (1990)

Product citations

N.Endlich et al., Exp. Nephrol., 9, 436 (2001)
E.A.G.Blomme et al., J. Invest. Dermatol., 112, 788 (1999)