(Tyr³⁶)-pTH-Related Protein (1-36) (human, mouse, rat) 4031193 | Bachem https://shop.bachem.com/4031193.html

Return to Previous Page

Availability: In stock

(Tyr³⁶)-pTH-Related Protein (1-36) (human, mouse, rat)
H-Ala-Val-Ser-Glu-His-Gln-Leu-Leu-His-Asp-Lys-Gly-Lys-Ser-Ile-Gln-Asp-Leu-Arg-Arg-Arg-Phe-Phe-Leu-His-His-Leu-Ile-Ala-Glu-Ile-His-Thr-Ala-Glu-Tyr-OH

Product No.	Pack Size	Available	ADS InfoAnalytical Data Sheet	List Price	Online Order Price	Qty
4031193.0500	0.5 mg	Ships within 3-5 business days		CHF 473.00	CHF 439.89 (7%)
4031193.1000	1 mg	Ships within 1 business day	ADSExemplary Data Sheet of a current available lot.	CHF 851.00	CHF 791.43 (7%)

(Tyr³⁶)-pTHrP (1-36) has been used for radioiodination.

Catalog Number H-3208

One Letter Code AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEY

Synonyms (Tyr³⁶)-Hypercalcemia of Malignancy Factor (1-36) (human, mouse, rat)

Molecular Formula C₁₉₄H₃₀₃N₅₉O₅₃

Relative Molecular Mass 4309.91

CAS Registry Number 213779-11-4

Source Synthetic

Storage Conditions -20 ± 5 °C

Application Osteoporosis Research

Links / Documents: