PACAP-38 (6-38) (human, chicken, mouse, ovine, porcine, rat) 4031158

Return to Previous Page

Availability: In stock

PACAP-38 (6-38) (human, chicken, mouse, ovine, porcine, rat) trifluoroacetate salt
H-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH₂ trifluoroacetate salt

4031158

Product No.	Pack Size	Available	ADS InfoAnalytical Data Sheet	Unit Price	Online Order Price	Qty
4031158.0500	0.5 mg	Ships within 1 business day	ADSExemplary Data Sheet of a current available lot.	CHF 263.00	CHF 244.59 (7%)
4031158.1000	1 mg	Ships within 1 business day	ADSExemplary Data Sheet of a current available lot.	CHF 442.00	CHF 411.06 (7%)

Add to Wish List

Add to Compare

Details

The PACAP selective antagonist PACAP (6-38) is a potent and selective inhibitor of PACAP-27-stimulated pituitary adenylate cyclase with a Ki values of 150 nM.

Catalog Number H-2734

APC Number 34-0-19

One Letter Code FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH₂

Synonyms Pituitary Adenylate Cyclase Activating Polypeptide-38 (6-38) (human, chicken, mouse, ovine, porcine, rat)

Molecular Formula C₁₈₂H₃₀₀N₅₆O₄₅S

Relative Molecular Mass 4024.80

CAS Registry Number [143748-18-9] net

Source Synthetic

Storage Conditions -20 ± 5 °C

Areas of Interest Cancer Research

Links / Documents:

Brochures: