×

Cookie Settings

We use cookies so that we can offer you the best possible website experience. This includes cookies which are necessary for the operations of the website, as well as cookies that are only used for anonymous statistical purposes, for comfort settings or to display personalized content. Please note that based on your settings, it is possible that not all functionalities of the website will be available. You can find further information in our privacy policy.

Please make your personal preference here:

Imprint

 
 
Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4031154
Return to Previous Page
4031154

Availability: In stock

PHI-27 (porcine)
H-His-Ala-Asp-Gly-Val-Phe-Thr-Ser-Asp-Phe-Ser-Arg-Leu-Leu-Gly-Gln-Leu-Ser-Ala-Lys-Lys-Tyr-Leu-Glu-Ser-Leu-Ile-NH₂

4031154

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4031154.1000 1 mg Ships within 3-5 business days  
CHF 420.00
CHF 390.60 (7%)

Details

Porcine intestinal peptide which belongs to the glucagon-secretin family. It exhibits biological activities similar to vasoactive intestinal peptide (VIP) and secretin.
Catalog Number H-3730
APC Number 48-4-10
One Letter Code HADGVFTSDFSRLLGQLSAKKYLESLI-NH₂
Synonyms PHI (PHI-27), porcine
Molecular Formula C₁₃₆H₂₁₆N₃₆O₄₀
Relative Molecular Mass 2995.43
CAS Registry Number 80458-29-3
Source Synthetic
Storage Conditions -20 ± 5 °C
Application Cardiovascular System & Diseases
Gastrointestinal Research
Links / Documents:
Brochures:

Product citations

B.Ahrén and J.Lundquist, Neuropeptides, 11, 159 (1988)
K.Tatemoto and V.Mutt, Proc. Natl. Acad. Sci. USA, 78, 6603 (1981)