×

Cookie Settings

We use cookies so that we can offer you the best possible website experience. This includes cookies which are necessary for the operations of the website, as well as cookies that are only used for anonymous statistical purposes, for comfort settings or to display personalized content. Please note that based on your settings, it is possible that not all functionalities of the website will be available. You can find further information in our privacy policy.

Please make your personal preference here:

Imprint

 
 
Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4031084
Return to Previous Page
4031084

Availability: In stock

PACAP-27 (human, mouse, ovine, porcine, rat) trifluoroacetate salt
H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH₂ trifluoroacetate salt

4031084

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4031084.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 368.00
CHF 342.24 (7%)
4031084.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 630.00
CHF 585.90 (7%)

Details

PACAP-38 and its N-terminal fragment PACAP-27 are neuropeptides originally isolated from ovine hypothalamus, but also found in humans and rats. Both PACAP-27, which shows considerable homology with vasoactive intestinal polypeptide (VIP), and PACAP-38 stimulate adenylate cyclase much more potently than VIP. Specific PACAP receptors have been identified in different tissues and cell lines.Kojro et al. observed that the PAC1 agonists PACAP-27 and PACAP-38 strongly increased the activity of α-secretase, thus promoting the non-amyloidogenic processing of amyloid precursor protein.
Catalog Number H-1172
APC Number 34-0-40
One Letter Code HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH₂
Synonyms PACAP-38 (1-27) amide (human, mouse, ovine, porcine, rat), Pituitary Adenylate Cyclase Activating Polypeptide-27 (human, mouse, ovine, porcine, rat)
Molecular Formula C₁₄₂H₂₂₄N₄₀O₃₉S
Relative Molecular Mass 3147.65
CAS Registry Number 127317-03-7
Source Synthetic
Storage Conditions -20 ± 5 °C
Application Pituitary & Hypothalamic Hormones
Links / Documents:
Brochures:

Bachem product citations

J.Wojcieszak and J.B.Zawilska, J. Mol. Neurosci., 54, 463 (2014)
K.Y.Shivers et al., Biochim. Biophys. Acta, 1842, 1707 (2014)
D.Wootten et al., Br. J. Pharmacol., 168, 822 (2013)
M.J.Metcalfe et al., Cell Death Dis., 3, e326 (2012)
D.B.Hoover et al., J. Pharmacol. Exp. Ther., 331, 197 (2009)
P.Radziszewski et al., Gynecol. Endocrinol., 25, 362 (2009)
M.Nowicki et al., Anat. Histol. Embryol., 36, 311 (2007)
L.G.Ermilov et al., J. Physiol., 560, 231 (2004)
C.M.Anderson et al., Br. J. Pharmacol., 138, 564 (2003)
P.M.Germano et al., Peptides, 22, 861 (2001)
C.Otto et al., Mech. Dev., 94, 111 (2000)
E.J.Whalen et al., Am. J. Physiol., 276, H2117 (1999)
E.J.Whalen et al., Am. J. Physiol., 277, R1453 (1999)

Product citations

D.Rat et al., FASEB J., 25, 3208 (2011)
E.Kojro et al., FASEB J., 20, 512 (2006)
I.Tatsuno et al., Peptides, 15, 55 (1994)
D.Spengler et al., Nature, 365, 170 (1993)
A.Arimura, Trends Endocrinol. Metab., 3, 288 (1992)
P.Robberecht et al., FEBS Lett., 286, 133 (1991)
A.Cauvin et al., Peptides, 11, 773 (1990)
A.Miyata et al., Biochem. Biophys. Res. Commun., 170, 643 (1990)
C.Kimura et al., Biochem. Biophys. Res. Commun., 166, 81 (1990)
K.Ogi et al., Biochem. Biophys. Res. Commun., 173, 1271 (1990)