×

Cookie Settings

We use cookies so that we can offer you the best possible website experience. This includes cookies which are necessary for the operations of the website, as well as cookies that are only used for anonymous statistical purposes, for comfort settings or to display personalized content. Please note that based on your settings, it is possible that not all functionalities of the website will be available. You can find further information in our privacy policy.

Please make your personal preference here:

Imprint

 
 
Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4030663
Return to Previous Page
4030663

Availability: In stock

GLP-1 (7-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt
H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH₂ trifluoroacetate salt

4030663

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4030663.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 263.00
CHF 244.59 (7%)
4030663.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 473.00
CHF 439.89 (7%)

Details

GLP-1 (7-36) amide is secreted from the lower small intestine and shows a strong insulinotropic effect. GLP-1 (7-36) amide is considered as the most important incretin hormone. Its action is mediated by receptors expressed by the endocrine pancreatic B-cells. Considerable interest has focused on the development of this peptide as a therapeutic strategy for non-insulin-dependent (type 2 ) diabetes mellitus and associated neuropathy.
Catalog Number H-6795
APC Number 46-1-13
One Letter Code HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH₂
Synonyms Glucagon-Like Peptide 1 (7-36) amide (human, bovine, guinea pig, mouse, rat), Glucagon-Like Peptide I (7-36), amide, human, Preproglucagon (98-127) amide (human, bovine, guinea pig, mouse, rat), Proglucagon (78-107) amide (human, bovine, guinea pig, mouse, rat)
Molecular Formula C₁₄₉H₂₂₆N₄₀O₄₅
Relative Molecular Mass 3297.68
CAS Registry Number 107444-51-9
Source Synthetic
Storage Conditions -20 ± 5 °C
Keywords Insulinotropic hormone; Incretin
Application Diabetes
Links / Documents:
Brochures:

Bachem product citations

J.Naylor et al., J. Vis. Exp., (2016)
R.L.Dods and D.Donnelly, Biosci. Rep., 36, e00285 (2016)
T.Gurlo et al., J. Histotechnol., 39, 8 (2016)
B.Waser et al., Mod. Pathol., 28, 391 (2015)
N.J.Wewer Albrechtsen et al., Endocr. Connect, 4, 50 (2015)
A.E.Relling et al., Canadian Journal of Animal Science, 94, 357 (2014)
B.L.Panaro et al., Cell Metab., 20, 1018 (2014)
K.A.Sjoberg et al., Am. J. Physiol. Endocrinol. Metab., 306, E355 (2014)
M.J.Bak et al., Diabetes Obes. Metab., 16, 1155 (2014)
O.E.Levy et al., PLoS One, 9, e87704 (2014)
T.A.Schwetz et al., PLoS One, 9, e113020 (2014)
T.A.Schwetz et al., PLoS One, 9, e113020 (2014)
I.L.Beales, F1000Res., 2, 56 (2013)
J.M.Chehade et al., Metabolism, 62, 265 (2013)
B.J.Lamont et al., J. Clin. Invest., 122, 388 (2012)
D.Schelshorn et al., Mol. Pharmacol., 81, 309 (2012)
P.M.Hellstrom et al., Regul. Pept., 179, 71 (2012)
T.D.Challa et al., J. Biol. Chem., 287, 6421 (2012)
A.M.Deane et al., Crit. Care, 15, R35 (2011)
B.Waser et al., Neuroendocrinology, 94, 291 (2011)
K.Coopman et al., Mol. Endocrinol., 25, 1804 (2011)
M.Goebel-Stengel et al., Anal. Biochem., 414, 38 (2011)
S.Shirasawa et al., Stem Cells Dev., 20, 1071 (2011)
S.Shirasawa et al., Biochem. Biophys. Res. Commun., 410, 608 (2011)
Y.F.Xiao et al., Cardiovasc. Diabetol., 10, 6 (2011)
B.Nuche-Berenguer et al., J. Cell. Physiol., 225, 585 (2010)
I.Hadjiyanni et al., Diabetologia, 53, 730 (2010)
J.C.Reubi et al., Diabetologia, 53, 2641 (2010)
K.Ban et al., Endocrinology, 151, 1520 (2010)
K.Coopman et al., J. Pharmacol. Exp. Ther., 334, 795 (2010)
Q.Chen et al., Am. J. Physiol. Endocrinol. Metab., 299, E62 (2010)
Q.Chen et al., J. Biol. Chem., 285, 24508 (2010)
S.M.Gardiner et al., Br. J. Pharmacol., 161, 92 (2010)
S.M.Gardiner et al., Br. J. Pharmacol., 161, 92 (2010)
W.Gu et al., Am. J. Physiol. Endocrinol. Metab., 299, E624 (2010)
A.Maida et al., Gastroenterology, 137, 2146 (2009)
B.Nuche-Berenguer et al., Calcif. Tissue Int., 84, 453 (2009)
E.B.Ruttimann et al., Endocrinology, 150, 1174 (2009)
A.Fulurija et al., PLoS One, 3, e3163 (2008)
D.Tews et al., Horm. Metab. Res., 40, 172 (2008)
M.Dong et al., Mol. Endocrinol., 22, 1489 (2008)
Y.S.Youn et al., Eur. J. Pharm. Biopharm., 68, 667 (2008)
C.N.Andrews et al., Neurogastroenterol. Motil., 19, 716 (2007)
H.Gao et al., Endocrine, 32, 90 (2007)
P.Schlatter et al., Regul. Pept., 141, 120 (2007)
B.D.Green et al., Eur. J. Pharmacol., 547, 192 (2006)
S.H.Lee et al., Bioconjug. Chem., 16, 377 (2005)
J.Buteau et al., Diabetologia, 47, 806 (2004)
S.A.Hinke et al., Life Sci., 75, 1857 (2004)
A.Stark and R.Mentlein, Regul. Pept., 108, 97 (2002)
E.Vara et al., Am. J. Respir. Crit. Care Med., 163, 840 (2001)
B.Yusta et al., J. Biol. Chem., 274, 30459 (1999)
M.Hassan et al., Nucl. Med. Biol., 26, 413 (1999)

Product citations

L.Brunetti et al., Peptides, 29, 1377 (2008)
J.J.Meier et al., Biodrugs, 17, 93 (2003)
T.Perry and N.H.Greig, Trends Pharmacol. Sci., 24, 377 (2003)
M.A.Nauck et al., Exp. Clin. Endocrinol. Diabetes, 105, 187 (1997)
H.C.Fehmann et al., Peptides, 15, 453 (1994)
P.A.Martin and A.Faulkner, Comp. Biochem. Physiol. Comp. Physiol., 105, 705 (1993)
J.-P.Raufman et al., J. Biol. Chem., 267, 21432 (1992)
C.Orskov and J.H.Nielsen, FEBS Lett., 229, 175 (1988)
B.Kreymann et al., Lancet, 2, 1300 (1987)
G.I.Bell et al., Nature, 304, 368 (1983)
Related products