Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

GLP-1 (7-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt
H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH₂ trifluoroacetate salt

4030663

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4030663.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 263.00
CHF 244.59 (7%)
4030663.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 473.00
CHF 439.89 (7%)
Add to Wish List
Add to Compare

Details

GLP-1 (7-36) amide is secreted from the lower small intestine and shows a strong insulinotropic effect. GLP-1 (7-36) amide is considered as the most important incretin hormone. Its action is mediated by receptors expressed by the endocrine pancreatic B-cells. Considerable interest has focused on the development of this peptide as a therapeutic strategy for non-insulin-dependent (type 2 ) diabetes mellitus and associated neuropathy.
Catalog Number H-6795
APC Number 46-1-13
One Letter Code HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH₂
Synonyms Glucagon-Like Peptide 1 (7-36) amide (human, bovine, guinea pig, mouse, rat), Preproglucagon (98-127) amide (human, bovine, guinea pig, mouse, rat), Proglucagon (78-107) amide (human, bovine, guinea pig, mouse, rat), Glucagon-Like Peptide I (7-36), amide, human
Molecular Formula C₁₄₉H₂₂₆N₄₀O₄₅
Relative Molecular Mass 3297.68
CAS Registry Number [107444-51-9] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Keywords Insulinotropic hormone; Incretin
Areas of Interest Diabetes

Bachem product citations

A.E.Relling et al., Canadian Journal of Animal Science, 94, 357 (2014)