Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4030663
Return to Previous Page
4030663

Availability: In stock

GLP-1 (7-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt
H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH₂ trifluoroacetate salt

4030663

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4030663.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 263.00
CHF 244.59 (7%)
4030663.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 473.00
CHF 439.89 (7%)
Add to Wish List
Add to Compare

Details

GLP-1 (7-36) amide is secreted from the lower small intestine and shows a strong insulinotropic effect. GLP-1 (7-36) amide is considered as the most important incretin hormone. Its action is mediated by receptors expressed by the endocrine pancreatic B-cells. Considerable interest has focused on the development of this peptide as a therapeutic strategy for non-insulin-dependent (type 2 ) diabetes mellitus and associated neuropathy.
Catalog Number H-6795
APC Number 46-1-13
One Letter Code HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH₂
Synonyms Glucagon-Like Peptide 1 (7-36) amide (human, bovine, guinea pig, mouse, rat), Preproglucagon (98-127) amide (human, bovine, guinea pig, mouse, rat), Proglucagon (78-107) amide (human, bovine, guinea pig, mouse, rat), Glucagon-Like Peptide I (7-36), amide, human
Molecular Formula C₁₄₉H₂₂₆N₄₀O₄₅
Relative Molecular Mass 3297.68
CAS Registry Number [107444-51-9] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Keywords Insulinotropic hormone; Incretin
Areas of Interest Diabetes
Links / Documents:
Brochures:

Bachem product citations

J.Naylor et al., J. Vis. Exp., (2016)
R.L.Dods and D.Donnelly, Biosci. Rep., 36, e00285 (2016)
T.Gurlo et al., J. Histotechnol., 39, 8 (2016)
B.Waser et al., Mod. Pathol., 28, 391 (2015)
N.J.Wewer Albrechtsen et al., Endocr. Connect, 4, 50 (2015)
A.E.Relling et al., Canadian Journal of Animal Science, 94, 357 (2014)
M.J.Bak et al., Diabetes Obes. Metab., 16, 1155 (2014)
O.E.Levy et al., PLoS One, 9, e87704 (2014)
B.L.Panaro et al., Cell Metab., 20, 1018 (2014)
T.A.Schwetz et al., PLoS One, 9, e113020 (2014)
T.A.Schwetz et al., PLoS One, 9, e113020 (2014)
K.A.Sjoberg et al., Am. J. Physiol. Endocrinol. Metab., 306, E355 (2014)
I.L.Beales, F1000Res., 2, 56 (2013)
J.M.Chehade et al., Metabolism, 62, 265 (2013)
T.D.Challa et al., J. Biol. Chem., 287, 6421 (2012)
P.M.Hellstrom et al., Regul. Pept., 179, 71 (2012)
B.J.Lamont et al., J. Clin. Invest., 122, 388 (2012)
D.Schelshorn et al., Mol. Pharmacol., 81, 309 (2012)
K.Coopman et al., Mol. Endocrinol., 25, 1804 (2011)
A.M.Deane et al., Crit. Care, 15, R35 (2011)
M.Goebel-Stengel et al., Anal. Biochem., 414, 38 (2011)
S.Shirasawa et al., Biochem. Biophys. Res. Commun., 410, 608 (2011)
S.Shirasawa et al., Stem Cells Dev., 20, 1071 (2011)
B.Waser et al., Neuroendocrinology, 94, 291 (2011)
Y.F.Xiao et al., Cardiovasc. Diabetol., 10, 6 (2011)
K.Ban et al., Endocrinology, 151, 1520 (2010)
Q.Chen et al., J. Biol. Chem., 285, 24508 (2010)
Q.Chen et al., Am. J. Physiol. Endocrinol. Metab., 299, E62 (2010)
K.Coopman et al., J. Pharmacol. Exp. Ther., 334, 795 (2010)
S.M.Gardiner et al., Br. J. Pharmacol., 161, 92 (2010)
S.M.Gardiner et al., Br. J. Pharmacol., 161, 92 (2010)
W.Gu et al., Am. J. Physiol. Endocrinol. Metab., 299, E624 (2010)
I.Hadjiyanni et al., Diabetologia, 53, 730 (2010)
B.Nuche-Berenguer et al., J. Cell. Physiol., 225, 585 (2010)
J.C.Reubi et al., Diabetologia, 53, 2641 (2010)
A.Maida et al., Gastroenterology, 137, 2146 (2009)
B.Nuche-Berenguer et al., Calcif. Tissue Int., 84, 453 (2009)
E.B.Ruttimann et al., Endocrinology, 150, 1174 (2009)
M.Dong et al., Mol. Endocrinol., 22, 1489 (2008)
A.Fulurija et al., PLoS One, 3, e3163 (2008)
D.Tews et al., Horm. Metab. Res., 40, 172 (2008)
Y.S.Youn et al., Eur. J. Pharm. Biopharm., 68, 667 (2008)
C.N.Andrews et al., Neurogastroenterol. Motil., 19, 716 (2007)
H.Gao et al., Endocrine, 32, 90 (2007)
P.Schlatter et al., Regul. Pept., 141, 120 (2007)
B.D.Green et al., Eur. J. Pharmacol., 547, 192 (2006)
S.H.Lee et al., Bioconjug. Chem., 16, 377 (2005)
J.Buteau et al., Diabetologia, 47, 806 (2004)
S.A.Hinke et al., Life Sci., 75, 1857 (2004)
A.Stark and R.Mentlein, Regul. Pept., 108, 97 (2002)
E.Vara et al., Am. J. Respir. Crit. Care Med., 163, 840 (2001)
M.Hassan et al., Nucl. Med. Biol., 26, 413 (1999)
B.Yusta et al., J. Biol. Chem., 274, 30459 (1999)

Product citations

L.Brunetti et al., Peptides, 29, 1377 (2008)
J.J.Meier et al., Biodrugs, 17, 93 (2003)
T.Perry and N.H.Greig, Trends Pharmacol. Sci., 24, 377 (2003)
M.A.Nauck et al., Exp. Clin. Endocrinol. Diabetes, 105, 187 (1997)
H.C.Fehmann et al., Peptides, 15, 453 (1994)
P.A.Martin and A.Faulkner, Comp. Biochem. Physiol. Comp. Physiol., 105, 705 (1993)
J.-P.Raufman et al., J. Biol. Chem., 267, 21432 (1992)
C.Orskov and J.H.Nielsen, FEBS Lett., 229, 175 (1988)
B.Kreymann et al., Lancet, 2, 1300 (1987)
G.I.Bell et al., Nature, 304, 368 (1983)
Related products