Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Gastric Inhibitory Polypeptide (1-30) amide (porcine) trifluoroacetate salt
H-Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-NH₂ trifluoroacetate salt

4030659

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4030659.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 263.00
CHF 244.59 (7%)
4030659.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 473.00
CHF 439.89 (7%)
Add to Wish List
Add to Compare

Details

This GIP fragment has potent insulinotropic activity in the isolated, perfused rat pancreas but greatly reduced somatostatinotropic activity in the isolated perfused rat stomach. The site responsible for insulinotropic activity apparently lies between residues 19 and 30 of GIP.
Catalog Number H-3824
APC Number 46-4-10
One Letter Code YAEGTFISDYSIAMDKIRQQDFVNWLLAQK-NH₂
Synonyms GIP (1-30) amide (porcine), Glucose-Dependent Insulinotropic Polypeptide (1-30) amide (porcine), Gastric Inhibitory Peptide (1-30), amide, porcine
Molecular Formula C₁₆₂H₂₄₅N₄₁O₄₇S
Relative Molecular Mass 3551.04
CAS Registry Number [134846-93-8] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Diabetes