Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4030658
Return to Previous Page
4030658

Availability: In stock

Gastric Inhibitory Polypeptide (human)
H-Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln-OH

4030658

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4030658.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 315.00
CHF 292.95 (7%)
4030658.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 578.00
CHF 537.54 (7%)

Details

Gastric inhibitory polypeptide (GIP), an incretin, represents an essential regulator of insulin secretion and glucose homeostasis.
Catalog Number H-5645
APC Number 46-1-60
One Letter Code YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
Synonyms GIP (human), Glucose-Dependent Insulinotropic Polypeptide (human), GIP (1-42) (human)
Molecular Formula C₂₂₆H₃₃₈N₆₀O₆₆S
Relative Molecular Mass 4983.60
CAS Registry Number 100040-31-1
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Diabetes
Links / Documents:

Bachem product citations

A.H.Sparre-Ulrich et al., Br. J. Pharmacol., 173, 27 (2016)
J.L.Berlier et al., Stem Cell Rev., 11, 841 (2015)
K.Tatarkiewicz et al., Diabetes Obes. Metab., 16, 75 (2014)
C.Dirksen et al., Diabetologia, 56, 2679 (2013)
D.J.Hodson et al., J. Clin. Invest., 123, 4182 (2013)
K.Timper et al., Am. J. Physiol. Endocrinol. Metab., 304, e1 (2013)
M.S.Engelstoft et al., Mol. Metab., 2, 376 (2013)
P.Ravn et al., J. Biol. Chem., 288, 19760 (2013)
B.Waser et al., Neuroendocrinology, 94, 291 (2011)
F.M.Keane et al., FEBS J., 278, 1316 (2011)
J.de Heer et al., Diabetologia, 51, 2263 (2008)
T.L.Mazzuco et al., Arq. Bras. Endocrinol. Metabol., 51, 1452 (2007)
T.L.Mazzuco et al., Arq. Bras. Endocrinol. Metabol., 51, 1452 (2007)
E.Louiset et al., J. Clin. Endocrinol. Metab., 91, 4578 (2006)
C.Noordam et al., J. Pediatr. Endocrinol. Metab., 15, 853 (2002)
S.A.Hinke et al., Biochim. Biophys. Acta, 1547, 143 (2001)

Product citations

N.Irwin and P.R.Flatt, Diabetologia, 52, 1724 (2009)
M.A.Nauck et al., Diabetes, 53 (Suppl. 3), S190 (2004)
T.Vahl and D.D'Alessio, Curr. Opin. Clin. Nutr. Metab. Care, 6, 461 (2003)
H.C.Fehmann and B.Goke, Peptides, 16, 1149 (1995)
M.Bryer-Ash et al., Regul. Pept., 51, 101 (1994)
H.Yajima et al., Chem. Pharm. Bull., 33, 3578 (1985)
A.J.Moody et al., FEBS Lett., 172, 142 (1984)