Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Galanin (mouse, rat)
H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-His-Gly-Leu-Thr-NH₂

4030645

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4030645.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 263.00
CHF 244.59 (7%)
4030645.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 473.00
CHF 439.89 (7%)

Details

The isolation and characterization of cDNAs encoding rat galanin and its precursor peptide reveal that rat galanin is synthesized initially as part of a 124-amino acid precursor that includes a signal peptide, galanin, and a 60-amino acid galanin mRNA-associated peptide. The neuropeptide galanin shows multiple inhibitory actions on neurotransmission and memory. In Alzheimer's disease, increased galanin-containing fibers hyperinnervate cholinergic neurons within the basal forebrain in association with a decline in cognition.
Catalog Number H-7450
APC Number 46-5-10
One Letter Code GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH₂
Molecular Formula C₁₄₁H₂₁₁N₄₃O₄₁
Relative Molecular Mass 3164.49
CAS Registry Number 114547-31-8
Source Synthetic
Storage Conditions -20 ± 5 °C
Application Alzheimer's Disease