Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4030639
Return to Previous Page
4030639

Availability: In stock

rec IGF-II (1-67) (human)
H-Ala-Tyr-Arg-Pro-Ser-Glu-Thr-Leu-Cys-Gly-Gly-Glu-Leu-Val-Asp-Thr-Leu-Gln-Phe-Val-Cys-Gly-Asp-Arg-Gly-Phe-Tyr-Phe-Ser-Arg-Pro-Ala-Ser-Arg-Val-Ser-Arg-Arg-Ser-Arg-Gly-Ile-Val-Glu-Glu-Cys-Cys-Phe-Arg-Ser-Cys-Asp-Leu-Ala-Leu-Leu-Glu-Thr-Tyr-Cys-Ala-Thr-Pro-Ala-Lys-Ser-Glu-OH

4030639

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4030639.0010 10 µg Ships within 3-5 business days  
CHF 115.00
CHF 106.95 (7%)
4030639.0050 50 µg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 305.00
CHF 283.65 (7%)
Add to Wish List
Add to Compare

Details

approx. ED₅₀ = 0.1 ng/mL
IGF-II seems to be specifically involved in fetal growth, but otherwise shows similar biological activities to IGF-I.
Catalog Number H-7020
One Letter Code AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE
Molecular Formula C₃₂₁H₄₉₉N₉₃O₁₀₁S₆
Relative Molecular Mass 7469.46
CAS Registry Number [96081-16-2]
Source Recombinant
Storage Conditions -20 ± 5 °C
Keywords Recombinant protein
Areas of Interest Cell Culture
Diabetes
Links / Documents:
Brochures:

Bachem product citations

V.Jimenez-Amilburu et al., Gen. Comp. Endocrinol., 188, 151 (2013)
J.L.Kreiling et al., FEBS J., 279, 2695 (2012)
M.Rius-Francino et al., Gen. Comp. Endocrinol., 172, 44 (2011)
S.M.de la Monte et al., Hepatol. Res., 41, 386 (2011)
S.M.Denucci et al., Gastroenterol. Res. Pract., 2010, (2010)
E.Heinrich et al., Prostate, 68, 1763 (2008)
S.M.de la Monte et al., Alcohol. Clin. Exp. Res., 32, 1630 (2008)
H.B.Boldt et al., J. Biol. Chem., 279, 38525 (2004)
S.A.Rogers and M.R.Hammerman, Organogenesis, 1, 22 (2004)
R.H.McCusker et al., Endocrine, 21, 279 (2003)
R.Braczkowski et al., Cancer, 95, 1735 (2002)
L.S.Laursen et al., Biochem. J., 367, 31 (2002)
G.Iniguez et al., Reproduction, 122, 865 (2001)
C.Richman et al., J. Bone Miner. Res., 16, 386 (2001)
S.J.York et al., J. Biol. Chem., 274, 1164 (1999)
A.Hofig et al., Biol. Reprod., 45, 533 (1991)

Product citations

W.S.Cohick and D.R.Clemmons, Annu. Rev. Physiol., 55, 131 (1993)
D.M.Buergisser et al., Biochem. Biophys. Res. Commun., 169, 832 (1990)
R.E.Humbel, Eur. J. Biochem., 190, 445 (1990)
M.C.Smith et al., J. Biol. Chem., 264, 9314 (1989)
E.Rinderknecht and R.E.Humbel, FEBS Lett., 89, 283 (1978)