Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Promobanner OCT 2020

Availability: In stock

4030639

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4030639.0050 50 µg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 305.00
CHF 283.65 (7%)

Details

approx. ED₅₀ = 0.1 ng/mL IGF-II seems to be specifically involved in fetal growth, but otherwise shows similar biological activities to IGF-I.
Catalog Number H-7020
One Letter Code AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE
Molecular Formula C₃₂₁H₄₉₉N₉₃O₁₀₁S₆
Relative Molecular Mass 7469.46
CAS Registry Number 96081-16-2
Source Recombinant
Storage Conditions -20 ± 5 °C
Keywords Recombinant protein
Application Cell Culture
Diabetes