Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4030639
Return to Previous Page

Promobanner OCT 2020

4030639

Availability: In stock

4030639

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4030639.0050 50 µg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 305.00
CHF 283.65 (7%)

Details

approx. ED₅₀ = 0.1 ng/mL IGF-II seems to be specifically involved in fetal growth, but otherwise shows similar biological activities to IGF-I.
Catalog Number H-7020
One Letter Code AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE
Molecular Formula C₃₂₁H₄₉₉N₉₃O₁₀₁S₆
Relative Molecular Mass 7469.46
CAS Registry Number 96081-16-2
Source Recombinant
Storage Conditions -20 ± 5 °C
Keywords Recombinant protein
Application Cell Culture
Diabetes
Links / Documents:
Brochures:

Bachem product citations

V.Jimenez-Amilburu et al., Gen. Comp. Endocrinol., 188, 151 (2013)
S.J.Redding et al., J. Endocrinol. Metab., 2, 72 (2012)
J.L.Kreiling et al., FEBS J., 279, 2695 (2012)
M.Rius-Francino et al., Gen. Comp. Endocrinol., 172, 44 (2011)
S.M.de la Monte et al., Hepatol. Res., 41, 386 (2011)
S.M.Denucci et al., Gastroenterol. Res. Pract., 2010, (2010)
E.Heinrich et al., Prostate, 68, 1763 (2008)
S.M.de la Monte et al., Alcohol. Clin. Exp. Res., 32, 1630 (2008)
H.B.Boldt et al., J. Biol. Chem., 279, 38525 (2004)
S.A.Rogers and M.R.Hammerman, Organogenesis, 1, 22 (2004)
R.H.McCusker et al., Endocrine, 21, 279 (2003)
L.S.Laursen et al., Biochem. J., 367, 31 (2002)
M.Khamaisi et al., Int. J. Exp. Diabetes Res., 3, 257 (2002)
R.Braczkowski et al., Cancer, 95, 1735 (2002)
C.Richman et al., J. Bone Miner. Res., 16, 386 (2001)
G.Iniguez et al., Reproduction, 122, 865 (2001)
S.J.York et al., J. Biol. Chem., 274, 1164 (1999)
A.Hofig et al., Biol. Reprod., 45, 533 (1991)

Product citations

W.S.Cohick and D.R.Clemmons, Annu. Rev. Physiol., 55, 131 (1993)
D.M.Buergisser et al., Biochem. Biophys. Res. Commun., 169, 832 (1990)
R.E.Humbel, Eur. J. Biochem., 190, 445 (1990)
M.C.Smith et al., J. Biol. Chem., 264, 9314 (1989)
E.Rinderknecht and R.E.Humbel, FEBS Lett., 89, 283 (1978)