Cecropin B 4030477 | Bachem https://shop.bachem.com/4030477.html

Return to Previous Page

Availability: In stock

Cecropin B
H-Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-NH₂

Product No.	Pack Size	Available	ADS InfoAnalytical Data Sheet	List Price	Online Order Price	Qty
4030477.0500	0.5 mg	Ships within 1 business day	ADSExemplary Data Sheet of a current available lot.	CHF 220.00	CHF 204.60 (7%)
4030477.1000	1 mg	Ships within 1 business day	ADSExemplary Data Sheet of a current available lot.	CHF 368.00	CHF 342.24 (7%)

Cecropin B is a 35-residue peptide which showed activity against different tumor cell lines.

Catalog Number H-3096

One Letter Code KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH₂

Molecular Formula C₁₇₆H₃₀₂N₅₂O₄₁S

Relative Molecular Mass 3834.73

CAS Registry Number 80451-05-4

Source Synthetic

Storage Conditions -20 ± 5 °C

Keywords Antitumor peptide

Areas of Interest Antimicrobial & Antiviral Peptides
Cancer Research

Links / Documents:

Brochures:

M.Bacalum and M.Radu, Int. J. Peptide Res. Ther., 21, 47 (2015)