×

Cookie Settings

We use cookies so that we can offer you the best possible website experience. This includes cookies which are necessary for the operations of the website, as well as cookies that are only used for anonymous statistical purposes, for comfort settings or to display personalized content. Please note that based on your settings, it is possible that not all functionalities of the website will be available. You can find further information in our privacy policy.

Please make your personal preference here:

Imprint

 
 
Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4030477
Return to Previous Page
4030477

Availability: In stock

Cecropin B
H-Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-NH₂

4030477

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4030477.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 220.00
CHF 204.60 (7%)
4030477.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 368.00
CHF 342.24 (7%)

Details

Cecropin B is a 35-residue peptide which showed activity against different tumor cell lines.
Catalog Number H-3096
One Letter Code KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH₂
Molecular Formula C₁₇₆H₃₀₂N₅₂O₄₁S
Relative Molecular Mass 3834.73
CAS Registry Number 80451-05-4
Source Synthetic
Storage Conditions -20 ± 5 °C
Keywords Antitumor peptide
Application Antimicrobial & Antiviral Peptides
Cancer Research
Links / Documents:
Brochures:

Bachem product citations

M.Bacalum and M.Radu, Int. J. Peptide Res. Ther., 21, 47 (2015)

Product citations

A.J.Moore et al., Pept. Res., 7, 265 (1994)
P.van Hofsten et al., Proc. Natl. Acad. Sci. USA, 82, 2240 (1985)