Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Promobanner OCT 2020

Availability: In stock

Tyr-α-CGRP (human) trifluoroacetate salt
H-Tyr-Ala-Cys-Asp-Thr-Ala-Thr-Cys-Val-Thr-His-Arg-Leu-Ala-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Gly-Val-Val-Lys-Asn-Asn-Phe-Val-Pro-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH₂ trifluoroacetate salt (Disulfide bond)

4030456

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4030456.1000 1 mg Ships within 3-5 business days  
CHF 368.00
CHF 342.24 (7%)
Catalog Number H-3354
APC Number 22-1-17
One Letter Code YACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAF-NH₂
Synonyms [Tyr0] Calcitonin Gene Related Peptide, human, Tyr-CGRP I (human)
Molecular Formula C₁₇₂H₂₇₆N₅₂O₅₁S₂
Relative Molecular Mass 3952.54
CAS Registry Number 124756-98-5
Source Synthetic
Storage Conditions -20 ± 5 °C