Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4030382
Return to Previous Page
4030382

Availability: In stock

Thr-Ala-Pro-Arg-Atrial Natriuretic Factor (1-28) (human, bovine, porcine) trifluoroacetate salt
H-Thr-Ala-Pro-Arg-Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr-OH trifluoroacetate salt (Disulfide bond)

4030382

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4030382.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 220.00
CHF 204.60 (7%)
4030382.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 410.00
CHF 381.30 (7%)

Details

Urodilatin, a 32 amino acid peptide, has originally been isolated from human urine. It belongs to the family of natriuretic-vasorelaxant peptides earlier found in heart atria. Cedidi et al. showed that urodilatin infusion may represent a concept for the treatment of therapy-resistant acute renal failure after liver transplantation. The use of ularitide is protected by patents. It is sold by Bachem for research purposes only, by expressed permission of Pharis Biotec GmbH, Hannover, Germany (www.pharis-biotec.com).
Catalog Number H-3046
APC Number 14-1-15
One Letter Code TAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY
Synonyms Urodilatin (95-126), Ularitide, Urodilatin
Molecular Formula C₁₄₅H₂₃₄N₅₂O₄₄S₃
Relative Molecular Mass 3505.98
CAS Registry Number 115966-23-9
Source Synthetic
Storage Conditions -20 ± 5 °C
Keywords Atrial natriuretic peptide detected in urine
Application Cardiovascular System & Diseases
Links / Documents:

Bachem product citations

P.Devillier et al., Eur. J. Pharmacol., 430, 325 (2001)
J.Bonatti et al., Eur. J. Cardiothorac. Surg., 17, 175 (2000)

Product citations

C.Cedidi et al., Eur. J. Clin. Invest., 24, 632 (1994)
T.Flüge et al., Eur. J. Pharmacol., 271, 395 (1994)
A.J.Kenny et al., Biochem. J., 291, 83 (1993)
V.di Marzo et al., Trends Pharmacol. Sci., 10, 91 (1989)
M.Gagelmann et al., FEBS Lett., 233, 249 (1988)