Amylin (8-37) (mouse, rat) 4030346

Return to Previous Page

Availability: In stock

Amylin (8-37) (mouse, rat)
H-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-Arg-Ser-Ser-Asn-Asn-Leu-Gly-Pro-Val-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH₂

Product No.	Pack Size	Available	ADS InfoAnalytical Data Sheet	Unit Price	Online Order Price	Qty
4030346.0500	0.5 mg	Ships within 1 business day	ADSExemplary Data Sheet of a current available lot.	CHF 189.00	CHF 175.77 (7%)
4030346.1000	1 mg	Ships within 1 business day	ADSExemplary Data Sheet of a current available lot.	CHF 325.00	CHF 302.25 (7%)

Add to Wish List

Add to Compare

The effect of IAPP (8-37) (mouse, rat), an amylin receptor antagonist, on the ANP release was attenuated in streptozotocin-treated rats.

Catalog Number H-2746

APC Number 74-5-13

One Letter Code ATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH₂

Molecular Formula C₁₄₀H₂₂₇N₄₃O₄₃

Relative Molecular Mass 3200.61

CAS Registry Number [138398-61-5]

Source Synthetic

Storage Conditions -20 ± 5 °C

Keywords IAPP antagonist

Areas of Interest Diabetes

Links / Documents:

Brochures: