Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4030325
Return to Previous Page
4030325

Availability: In stock

ACTH (1-39) (human) trifluoroacetate salt
H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe-OH trifluoroacetate salt

4030325

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4030325.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 189.00
CHF 175.77 (7%)
4030325.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 315.00
CHF 292.95 (7%)
Add to Wish List
Add to Compare

Details

The major regulator of adrenal cortex function. ACTH stimulates the synthesis of steroidal hormones.
Catalog Number H-1160
APC Number 10-1-10
One Letter Code SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
Synonyms Corticotropin
Molecular Formula C₂₀₇H₃₀₈N₅₆O₅₈S
Relative Molecular Mass 4541.13
CAS Registry Number [12279-41-3] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Keywords Peptide hormone
Areas of Interest Pituitary & Hypothalamic Hormones
Veterinary Medicine
Links / Documents:
Brochures:

Bachem product citations

M.Lelle et al., Mol. Pharm., 12, 4290 (2015)
G.S.Liu et al., Free Radic. Biol. Med., 70, 14 (2014)
N.Tennoune et al., Transl. Psychiatry, 4, e458 (2014)
J.M.Yoder et al., Am. J. Physiol. Regul. Integr. Comp. Physiol., 306, R837 (2014)
M.J.Agulleiro et al., PLoS One, 8, e65450 (2013)
C.M.Sturgeon, Best Pract. Res. Clin. Endocrinol. Metab., 27, 803 (2013)
D.R.Walkinshaw et al., J. Biol. Chem., 288, 5591 (2013)
S.N.Cooray et al., Endocrinology, 152, 495 (2011)
A.J.Alpert, Anal. Chem., 80, 62 (2008)
J.D.Spencer et al., J. Invest. Dermatol., 127, 411 (2007)
M.Moustafa et al., J. Invest. Dermatol., 119, 1244 (2002)
T.Kornfelt et al., Arch. Biochem. Biophys., 363, 43 (1999)

Product citations

N.Gallo-Payet and M.D.Payet, Microsc. Res. Tech., 61, 275 (2003)
E.Ottaviani et al., Curr. Pharm. Des., 5, 673 (1999)
Related products