Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Calcitonin (chicken) trifluoroacetate salt
H-Cys-Ala-Ser-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asp-Val-Gly-Ala-Gly-Thr-Pro-NH₂ trifluoroacetate salt
(Disulfide bond)

4030323

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4030323.0001 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 179.00
CHF 166.47 (7%)
4030323.0005 5 mg Ships within 3-5 business days  
CHF 714.00
CHF 664.02 (7%)
Add to Wish List
Add to Compare
Catalog Number H-3074
APC Number 22-7-12
One Letter Code CASLSTCVLGKLSQELHKLQTYPRTDVGAGTP-NH₂
Molecular Formula C₁₄₅H₂₄₀N₄₂O₄₆S₂
Relative Molecular Mass 3371.89
CAS Registry Number [100016-62-4]
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Osteoporosis Research

Product citations

T.Kurihara et al., Peptide Chemistry 1985, Proceedings of the 23rd Symposium, Kyoto, p. 173, Y.Kiso, ed., Protein Res. Foundation, Osaka, (1986)