BNP-45 (rat) 4030222

Return to Previous Page

Availability: In stock

BNP-45 (rat) trifluoroacetate salt
H-Ser-Gln-Asp-Ser-Ala-Phe-Arg-Ile-Gln-Glu-Arg-Leu-Arg-Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala-Val-Ser-Arg-Leu-Gly-Cys-Asp-Gly-Leu-Arg-Leu-Phe-OH trifluoroacetate salt
(Disulfide bond)

Product No.	Pack Size	Available	ADS InfoAnalytical Data Sheet	Unit Price	Online Order Price	Qty
4030222.0500	0.5 mg	Ships within 1 business day	ADSExemplary Data Sheet of a current available lot.	CHF 473.00	CHF 439.89 (7%)
4030222.1000	1 mg	Ships within 3-5 business days		CHF 840.00	CHF 781.20 (7%)

Add to Wish List

Add to Compare

Catalog Number H-8035

APC Number 14-5-20

One Letter Code SQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF

Synonyms Brain Natriuretic Peptide-45 (rat), BNP (1-45), rat

Molecular Formula C₂₁₃H₃₄₉N₇₁O₆₅S₃

Relative Molecular Mass 5040.75

CAS Registry Number [123337-89-3] net

Source Synthetic

Storage Conditions -20 ± 5 °C

Areas of Interest Regenerative Medicine

Links / Documents:

Brochures:

No brochures found.