×

Cookie Settings

We use cookies so that we can offer you the best possible website experience. This includes cookies which are necessary for the operations of the website, as well as cookies that are only used for anonymous statistical purposes, for comfort settings or to display personalized content. Please note that based on your settings, it is possible that not all functionalities of the website will be available. You can find further information in our privacy policy.

Please make your personal preference here:

Imprint

 
 
Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4030203
Return to Previous Page
4030203

Availability: In stock

Amyloid β-Protein (40-1) trifluoroacetate salt
H-Val-Val-Gly-Gly-Val-Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-Gly-Val-Asp-Glu-Ala-Phe-Phe-Val-Leu-Lys-Gln-His-His-Val-Glu-Tyr-Gly-Ser-Asp-His-Arg-Phe-Glu-Ala-Asp-OH trifluoroacetate salt

4030203

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4030203.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 132.00
CHF 122.76 (7%)
4030203.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 219.00
CHF 203.67 (7%)

Details

Reverse sequence of Aβ 1-40. Inactive control for Aβ40.
Catalog Number H-2972
One Letter Code VVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
Synonyms β-Amyloid (40-1)
Molecular Formula C₁₉₄H₂₉₅N₅₃O₅₈S
Relative Molecular Mass 4329.86
CAS Registry Number 144409-99-4
Source Synthetic
Storage Conditions -20 ± 5 °C
Application Alzheimer's Disease
Links / Documents:
Brochures:

Bachem product citations

T.Mita et al., Behav. Brain Res., 293, 189 (2015)
B.Maloney and D.K.Lahiri, Gene, 488, 1 (2011)
J.A.Bailey et al., Gene, 488, 13 (2011)
L.V.Colom et al., Neurobiol. Aging, 31, 46 (2010)
C.S.Casley et al., Brain Res., 1260, 65 (2009)
T.L.Kerrigan et al., Neuroreport, 19, 839 (2008)
E.Ferreiro et al., Neurobiol. Dis., 23, 669 (2006)
J.M.Alarcon et al., Peptides, 27, 95 (2006)
P.Garcao et al., J. Neurosci. Res., 84, 182 (2006)
S.Paratore et al., Genomics, 88, 468 (2006)
E.J.Shin et al., J. Pharmacol. Sci., 99, 117 (2005)
J.M.Mettenburg et al., J. Neurochem., 93, 53 (2005)
E.Ferreiro et al., J. Neurosci. Res., 76, 872 (2004)
S.I.Dikalov et al., Free Radic. Biol. Med., 36, 340 (2004)
E.Tsukamoto et al., J. Neurosci. Res., 73, 627 (2003)
C.Rovira et al., Biochem. Biophys. Res. Commun., 296, 1317 (2002)
Y.Zhang et al., J. Cell Biol., 156, 519 (2002)
Y.Zhang et al., J. Cell Biol., 156, 519 (2002)
Y.Furukawa-Hibi et al., Behav. Brain Res., 225, 222 (2001)
J.Vargas et al., Biophys. J., 79, 934 (2000)
L.A.Holcomb et al., Mech. Ageing Dev., 112, 135 (2000)
P.Chang and Y.Su, Brain Res. Brain Res. Protoc., 6, 6 (2000)

Product citations

M.Yaar et al., J. Clin. Invest., 100, 2333 (1997)
N.W.Kowall et al., Proc. Natl. Acad. Sci. USA, 88, 7247 (1991)
Related products