Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4030203
Return to Previous Page
4030203

Availability: In stock

Amyloid β-Protein (40-1) trifluoroacetate salt
H-Val-Val-Gly-Gly-Val-Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-Gly-Val-Asp-Glu-Ala-Phe-Phe-Val-Leu-Lys-Gln-His-His-Val-Glu-Tyr-Gly-Ser-Asp-His-Arg-Phe-Glu-Ala-Asp-OH trifluoroacetate salt

4030203

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4030203.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 132.00
CHF 122.76 (7%)
4030203.1000 1 mg Ships within 3-5 business days  
CHF 219.00
CHF 203.67 (7%)
Add to Wish List
Add to Compare

Details

Reverse sequence of Aβ 1-40. Inactive control for H-1194 and H-5568.
Catalog Number H-2972
One Letter Code VVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
Synonyms β-Amyloid (40-1)
Molecular Formula C₁₉₄H₂₉₅N₅₃O₅₈S
Relative Molecular Mass 4329.86
CAS Registry Number [144409-99-4] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Alzheimer's Disease
Links / Documents:
Brochures:

Bachem product citations

T.Mita et al., Behav. Brain Res., 293, 189 (2015)
J.A.Bailey et al., Gene, 488, 13 (2011)
L.V.Colom et al., Neurobiol. Aging, 31, 46 (2010)
C.S.Casley et al., Brain Res., 1260, 65 (2009)
T.L.Kerrigan et al., Neuroreport, 19, 839 (2008)
J.M.Alarcon et al., Peptides, 27, 95 (2006)
E.Ferreiro et al., Neurobiol. Dis., 23, 669 (2006)
P.Garcao et al., J. Neurosci. Res., 84, 182 (2006)
S.Paratore et al., Genomics, 88, 468 (2006)
J.M.Mettenburg et al., J. Neurochem., 93, 53 (2005)
E.J.Shin et al., J. Pharmacol. Sci., 99, 117 (2005)
S.I.Dikalov et al., Free Radic. Biol. Med., 36, 340 (2004)
E.Ferreiro et al., J. Neurosci. Res., 76, 872 (2004)
E.Tsukamoto et al., J. Neurosci. Res., 73, 627 (2003)
C.Rovira et al., Biochem. Biophys. Res. Commun., 296, 1317 (2002)
Y.Zhang et al., J. Cell Biol., 156, 519 (2002)
Y.Furukawa-Hibi et al., Behav. Brain Res., 225, 222 (2001)
P.Chang and Y.Su, Brain Res. Brain Res. Protoc., 6, 6 (2000)
L.A.Holcomb et al., Mech. Ageing Dev., 112, 135 (2000)
J.Vargas et al., Biophys. J., 79, 934 (2000)

Product citations

M.Yaar et al., J. Clin. Invest., 100, 2333 (1997)
N.W.Kowall et al., Proc. Natl. Acad. Sci. USA, 88, 7247 (1991)
Related products