×

Cookie Settings

We use cookies so that we can offer you the best possible website experience. This includes cookies which are necessary for the operations of the website, as well as cookies that are only used for anonymous statistical purposes, for comfort settings or to display personalized content. Please note that based on your settings, it is possible that not all functionalities of the website will be available. You can find further information in our privacy policy.

Please make your personal preference here:

Imprint

 
 
Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4030201
Return to Previous Page
4030201

Availability: In stock

Amylin (mouse, rat) trifluoroacetate salt
H-Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-Arg-Ser-Ser-Asn-Asn-Leu-Gly-Pro-Val-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH₂ trifluoroacetate salt (Disulfide bond)

4030201

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4030201.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 315.00
CHF 292.95 (7%)
4030201.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 525.00
CHF 488.25 (7%)

Details

Rat amylin (rIAPP) lacks the fibril-forming capacity of human amylin (hIAPP). As a consequence, toxic effects have been reported for the human but not for the rat peptide amide.
Catalog Number H-9475
APC Number 74-5-10
One Letter Code KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH₂
Synonyms Islet amyloid polypeptide (mouse, rat), IAPP (mouse, rat)
Molecular Formula C₁₆₇H₂₇₂N₅₂O₅₃S₂
Relative Molecular Mass 3920.45
CAS Registry Number 124447-81-0
Source Synthetic
Storage Conditions -20 ± 5 °C
Keywords Peptide hormone
Application Diabetes
Links / Documents:
Brochures:

Bachem product citations

C.Le Foll et al., Diabetes, 64, 1621 (2015)
M.Gao et al., Phys. Chem. Chem. Phys., 17, 8338 (2015)
E.Borchi et al., Redox Biol., 2, 114 (2014)
F.Bellia and G.Grasso, J. Mass Spectrom., 49, 274 (2014)
F.E.Braegger et al., Eur. J. Neurosci., 40, 3055 (2014)
J.P.Maianti et al., Nature, 511, 94 (2014)
Y.J.Park et al., Diabetologia, 57, 765 (2014)
A.R.Lomasney et al., Anal. Chem., 85, 7919 (2013)
K.Aston-Mourney et al., J. Biol. Chem., 288, 3553 (2013)
M.E.Carter et al., Nature, 503, 111 (2013)
N.G.Milton and J.R.Harris, Micron, 44, 246 (2013)
T.Fagerqvist et al., J. Neurochem., 126, 131 (2013)
Y.J.Park et al., Diabetologia, (2012)
R.J.Bailey et al., Br. J. Pharmacol., 166, 151 (2012)
T.Kusakabe et al., Am. J. Physiol. Endocrinol. Metab., 302, e924 (2012)
N.F.Dupuis et al., J. Am. Chem. Soc., 133, 7240 (2011)
P.Moreno et al., Peptides, 32, 2077 (2011)
A.S.Reddy et al., Biophys. J., 98, 443 (2010)
M.Ellegaard et al., Calcif. Tissue Int., 86, 249 (2010)
P.Y.Wielinga et al., Physiol. Behav., 101, 45 (2010)
Y.A.Lim et al., Proteomics, 10, 1621 (2010)
N.F.Dupuis et al., J. Am. Chem. Soc., 131, 18283 (2009)
S.Bedrood et al., Biochemistry, 48, 10568 (2009)
Y.L.Ling et al., J. Phys. Chem. B., 113, 2498 (2009)
S.Casas et al., Diabetologia, 51, 2252 (2008)
Y.A.Lim et al., FEBS Lett., 582, 2188 (2008)
D.H.Lopes et al., Biophys. J., 93, 3132 (2007)
K.Balali-Mood et al., FEBS Lett., 579, 1143 (2005)
A.Mollet et al., Physiol. Behav., 81, 149 (2004)
F.L.Piao et al., Regul. Pept., 117, 159 (2004)
F.L.Piao et al., Regul. Pept., 117, 159 (2004)
J.D.Green et al., J. Mol. Biol., 324, 877 (2004)
J.L.Larson and A.D.Miranker, J. Mol. Biol., 335, 221 (2004)
M.Anguiano et al., Biochemistry, 41, 11338 (2002)
M.Zaki et al., Gastroenterology, 123, 247 (2002)
J.Wang et al., Diabetes, 50, 534 (2001)
S.B.Padrick and A.D.Miranker, J. Mol. Biol., 308, 783 (2001)
A.Aldecoa et al., FEBS Lett., 471, 156 (2000)
C.E.Higham et al., FEBS Lett., 470, 55 (2000)
P.K.Wagoner et al., Proc. Natl. Acad. Sci. USA, 90, 9145 (1993)

Product citations

E.R.Szabo et al., FASEB J., 26, 272 (2012)
H.A.Golpon et al., Peptides, 24, 1157 (2003)
J.Green et al., J. Mol. Biol., 326, 1147 (2003)
J.D.Leffert et al., Proc. Natl. Acad. Sci. USA, 86, 3127 (1989)
Related products