Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4030201
Return to Previous Page
4030201

Availability: In stock

Amylin (mouse, rat) trifluoroacetate salt
H-Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-Arg-Ser-Ser-Asn-Asn-Leu-Gly-Pro-Val-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH₂ trifluoroacetate salt
(Disulfide bond)

4030201

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
4030201.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 315.00
CHF 292.95 (7%)
4030201.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 525.00
CHF 488.25 (7%)
Add to Wish List
Add to Compare

Details

Rat amylin (rIAPP) lacks the fibril-forming capacity of human amylin (hIAPP). As a consequence, toxic effects have been reported for the human but not for the rat peptide amide.
Catalog Number H-9475
APC Number 74-5-10
One Letter Code KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH₂
Synonyms IAPP (mouse, rat), Islet amyloid polypeptide (mouse, rat)
Molecular Formula C₁₆₇H₂₇₂N₅₂O₅₃S₂
Relative Molecular Mass 3920.45
CAS Registry Number [124447-81-0] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Keywords Peptide hormone
Areas of Interest Diabetes
Links / Documents:
Brochures:

Bachem product citations

M.Gao et al., Phys. Chem. Chem. Phys., 17, 8338 (2015)
C.Le Foll et al., Diabetes, 64, 1621 (2015)
F.Bellia and G.Grasso, J. Mass Spectrom., 49, 274 (2014)
E.Borchi et al., Redox Biol., 2, 114 (2014)
F.E.Braegger et al., Eur. J. Neurosci., 40, 3055 (2014)
J.P.Maianti et al., Nature, 511, 94 (2014)
Y.J.Park et al., Diabetologia, 57, 765 (2014)
K.Aston-Mourney et al., J. Biol. Chem., 288, 3553 (2013)
M.E.Carter et al., Nature, 503, 111 (2013)
T.Fagerqvist et al., J. Neurochem., 126, 131 (2013)
A.R.Lomasney et al., Anal. Chem., 85, 7919 (2013)
N.G.Milton and J.R.Harris, Micron, 44, 246 (2013)
Y.J.Park et al., Diabetologia, (2012)
R.J.Bailey et al., Br. J. Pharmacol., 166, 151 (2012)
T.Kusakabe et al., Am. J. Physiol. Endocrinol. Metab., 302, e924 (2012)
N.F.Dupuis et al., J. Am. Chem. Soc., 133, 7240 (2011)
P.Moreno et al., Peptides, 32, 2077 (2011)
M.Ellegaard et al., Calcif. Tissue Int., 86, 249 (2010)
Y.A.Lim et al., Proteomics, 10, 1621 (2010)
A.S.Reddy et al., Biophys. J., 98, 443 (2010)
P.Y.Wielinga et al., Physiol. Behav., 101, 45 (2010)
S.Bedrood et al., Biochemistry, 48, 10568 (2009)
N.F.Dupuis et al., J. Am. Chem. Soc., 131, 18283 (2009)
Y.L.Ling et al., J. Phys. Chem. B., 113, 2498 (2009)
M.P.Barnett et al., JOP, 9, 477 (2008)
S.Casas et al., Diabetologia, 51, 2252 (2008)
Y.A.Lim et al., FEBS Lett., 582, 2188 (2008)
D.H.Lopes et al., Biophys. J., 93, 3132 (2007)
K.Balali-Mood et al., FEBS Lett., 579, 1143 (2005)
J.D.Green et al., J. Mol. Biol., 324, 877 (2004)
J.L.Larson and A.D.Miranker, J. Mol. Biol., 335, 221 (2004)
A.Mollet et al., Physiol. Behav., 81, 149 (2004)
F.L.Piao et al., Regul. Pept., 117, 159 (2004)
F.L.Piao et al., Regul. Pept., 117, 159 (2004)
M.Anguiano et al., Biochemistry, 41, 11338 (2002)
M.Zaki et al., Gastroenterology, 123, 247 (2002)
S.B.Padrick and A.D.Miranker, J. Mol. Biol., 308, 783 (2001)
J.Wang et al., Diabetes, 50, 534 (2001)
A.Aldecoa et al., FEBS Lett., 471, 156 (2000)
C.E.Higham et al., FEBS Lett., 470, 55 (2000)
P.K.Wagoner et al., Proc. Natl. Acad. Sci. USA, 90, 9145 (1993)

Product citations

E.R.Szabo et al., FASEB J., 26, 272 (2012)
H.A.Golpon et al., Peptides, 24, 1157 (2003)
J.Green et al., J. Mol. Biol., 326, 1147 (2003)
J.D.Leffert et al., Proc. Natl. Acad. Sci. USA, 86, 3127 (1989)
Related products