×

Cookie Settings

We use cookies so that we can offer you the best possible website experience. This includes cookies which are necessary for the operations of the website, as well as cookies that are only used for anonymous statistical purposes, for comfort settings or to display personalized content. Please note that based on your settings, it is possible that not all functionalities of the website will be available. You can find further information in our privacy policy.

Please make your personal preference here:

Imprint

 
 
Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4030173
Return to Previous Page
4030173

Availability: In stock

ω-Agatoxin IVa trifluoroacetate salt
H-Lys-Lys-Lys-Cys-Ile-Ala-Lys-Asp-Tyr-Gly-Arg-Cys-Lys-Trp-Gly-Gly-Thr-Pro-Cys-Cys-Arg-Gly-Arg-Gly-Cys-Ile-Cys-Ser-Ile-Met-Gly-Thr-Asn-Cys-Glu-Cys-Lys-Pro-Arg-Leu-Ile-Met-Glu-Gly-Leu-Gly-Leu-Ala-OH trifluoroacetate salt (Disulfide bonds between Cys⁴ and Cys²⁰/Cys¹² and Cys²⁵/Cys¹⁹ and Cys³⁶/Cys²⁷ and Cys³⁴)

4030173

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4030173.0100 0.1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 368.00
CHF 342.24 (7%)
4030173.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 2,206.00
CHF 2,051.58 (7%)

Details

ω-Agatoxin IVa is a peptide isolated from the venom of the American funnel web spider, Agelenopsis aperta. ω-Aga IVa is a selective and potent blocker of the mammalian P-type voltage-dependent calcium channel.
Catalog Number H-1544
APC Number 41-0-68
One Letter Code KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA
Molecular Formula C₂₁₇H₃₆₀N₆₈O₆₀S₁₀
Relative Molecular Mass 5202.33
CAS Registry Number 145017-83-0
Source Synthetic
Storage Conditions -20 ± 5 °C
Application Ion Channel Modulating Agents
Links / Documents:

Bachem product citations

I.Arai and P.Jonas, Elife, 3, (2014)
C.Z.Zhu et al., J. Pain, 15, 387 (2014)
G.Ronzitti et al., J. Neurosci., 34, 10603 (2014)
R.Ramachandra et al., J. Neurophysiol., 110, 1535 (2013)
Y.S.Ermolyuk et al., Nat. Neurosci., 16, 1754 (2013)
P.Durante et al., J. Neurophysiol., 91, 1450 (2004)
P.E.Kunkler and R.P.Kraig, Hippocampus, 14, 356 (2004)
D.Sochivko et al., J. Physiol., 542, 699 (2002)

Product citations

H.Nishio et al., Peptides, Chemistry, Structure and Biology, Proceedings of the 13th American Peptide Symposium, Edmonton, Alberta, Canada, p. 31, R.S.Hodges and J.A.Smith, eds., Escom, Leiden, (1994)
H.Yu et al., Biochemistry, 32, 13123 (1993)
D.Phillips et al., U.S.Patent No. 5,122,596, (1992)
I.M.Mintz et al., Nature, 355, 827 (1992)