×

Cookie Settings

We use cookies so that we can offer you the best possible website experience. This includes cookies which are necessary for the operations of the website, as well as cookies that are only used for anonymous statistical purposes, for comfort settings or to display personalized content. Please note that based on your settings, it is possible that not all functionalities of the website will be available. You can find further information in our privacy policy.

Please make your personal preference here:

Imprint

 
 
Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4029353
Return to Previous Page
4029353

Availability: In stock

GLP-2 (1-34) (human) trifluoroacetate salt
H-His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-Arg-OH trifluoroacetate salt

4029353

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4029353.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 210.00
CHF 195.30 (7%)
4029353.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 378.00
CHF 351.54 (7%)
Catalog Number H-4766
APC Number 46-1-14
One Letter Code HADGSFSDEMNTILDNLAARDFINWLIQTKITDR
Synonyms Glucagon-Like Peptide 2-Arg (human), Glucagon-Like Peptide II, human, Preproglucagon (146-179) (human), Proglucagon (126-159) (human)
Molecular Formula C₁₇₁H₂₆₆N₄₈O₅₆S
Relative Molecular Mass 3922.35
CAS Registry Number 99120-49-7
Source Synthetic
Storage Conditions -20 ± 5 °C
Application Diabetes
Links / Documents:
Brochures:

Bachem product citations

J.A.Koehler et al., Mol. Endocrinol., 19, 459 (2005)
K.A.Vessey et al., Invest. Ophthalmol. Vis. Sci., 46, 3932 (2005)