GLP-2 (1-34) (human) 4029353

Return to Previous Page

Availability: In stock

GLP-2 (1-34) (human) trifluoroacetate salt
H-His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-Arg-OH trifluoroacetate salt

Product No.	Pack Size	Available	ADS InfoAnalytical Data Sheet	Unit Price	Online Order Price	Qty
4029353.0500	0.5 mg	Ships within 1 business day	ADSExemplary Data Sheet of a current available lot.	CHF 210.00	CHF 195.30 (7%)
4029353.1000	1 mg	Ships within 1 business day	ADSExemplary Data Sheet of a current available lot.	CHF 378.00	CHF 351.54 (7%)

Add to Wish List

Add to Compare

Catalog Number H-4766

APC Number 46-1-14

One Letter Code HADGSFSDEMNTILDNLAARDFINWLIQTKITDR

Synonyms Glucagon-Like Peptide 2-Arg (human), Preproglucagon (146-179) (human), Proglucagon (126-159) (human), Glucagon-Like Peptide II, human

Molecular Formula C₁₇₁H₂₆₆N₄₈O₅₆S

Relative Molecular Mass 3922.35

CAS Registry Number [99120-49-7] net

Source Synthetic

Storage Conditions -20 ± 5 °C

Areas of Interest Diabetes

Links / Documents:

Brochures: