×

Cookie Settings

We use cookies so that we can offer you the best possible website experience. This includes cookies which are necessary for the operations of the website, as well as cookies that are only used for anonymous statistical purposes, for comfort settings or to display personalized content. Please note that based on your settings, it is possible that not all functionalities of the website will be available. You can find further information in our privacy policy.

Please make your personal preference here:

Imprint

 
 
Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4028741
Return to Previous Page
4028741

Availability: In stock

Prolactin-Releasing Peptide (1-31) (rat)
H-Ser-Arg-Ala-His-Gln-His-Ser-Met-Glu-Thr-Arg-Thr-Pro-Asp-Ile-Asn-Pro-Ala-Trp-Tyr-Thr-Gly-Arg-Gly-Ile-Arg-Pro-Val-Gly-Arg-Phe-NH₂

4028741

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4028741.0500 0.5 mg Ships within 3-5 business days  
CHF 315.00
CHF 292.95 (7%)
4028741.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 578.00
CHF 537.54 (7%)
Catalog Number H-4384
APC Number 52-6-12
One Letter Code SRAHQHSMETRTPDINPAWYTGRGIRPVGRF-NH₂
Synonyms Preprolactin (23-53) (rat), PrRP31 (rat)
Molecular Formula C₁₅₆H₂₄₂N₅₄O₄₃S
Relative Molecular Mass 3594.04
CAS Registry Number 215510-06-8
Source Synthetic
Storage Conditions -20 ± 5 °C
Links / Documents: