Adrenomedullin (22-52) (human) 4028071

Return to Previous Page

Availability: In stock

Adrenomedullin (22-52) (human) trifluoroacetate salt
H-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH₂ trifluoroacetate salt

4028071

Product No.	Pack Size	Available	ADS InfoAnalytical Data Sheet	Unit Price	Online Order Price	Qty
4028071.0500	0.5 mg	Ships within 1 business day	ADSExemplary Data Sheet of a current available lot.	CHF 263.00	CHF 244.59 (7%)
4028071.1000	1 mg	Ships within 1 business day	ADSExemplary Data Sheet of a current available lot.	CHF 473.00	CHF 439.89 (7%)

Add to Wish List

Add to Compare

Details

This compound is a putative adrenomedullin receptor antagonist that inhibits the production of cAMP elicted by adrenomedullin. It is a more effective antagonist for adrenomedullin- and CGRP-specific receptors than α-CGRP (8-37) (human) (H-9895).

Catalog Number H-4144

APC Number 22-1-16

One Letter Code TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH₂

Molecular Formula C₁₅₉H₂₅₂N₄₆O₄₈

Relative Molecular Mass 3576.03

CAS Registry Number [159899-65-7] net

Source Synthetic

Storage Conditions -20 ± 5 °C

Areas of Interest Cardiovascular System & Diseases

Links / Documents:

Brochures:

No brochures found.