×

Cookie Settings

We use cookies so that we can offer you the best possible website experience. This includes cookies which are necessary for the operations of the website, as well as cookies that are only used for anonymous statistical purposes, for comfort settings or to display personalized content. Please note that based on your settings, it is possible that not all functionalities of the website will be available. You can find further information in our privacy policy.

Please make your personal preference here:

Imprint

 
 
Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4027991
Return to Previous Page
4027991

Availability: In stock

Amyloid β-Protein (42-1)
H-Ala-Ile-Val-Val-Gly-Gly-Val-Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-Gly-Val-Asp-Glu-Ala-Phe-Phe-Val-Leu-Lys-Gln-His-His-Val-Glu-Tyr-Gly-Ser-Asp-His-Arg-Phe-Glu-Ala-Asp-OH

4027991

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4027991.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 332.00
CHF 308.76 (7%)
4027991.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 589.00
CHF 547.77 (7%)

Details

Reverse sequence of Aβ 1-42, inactive control for the Aβ.
Catalog Number H-3976
APC Number 62-0-81
One Letter Code AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
Synonyms β-Amyloid (42-1)
Molecular Formula C₂₀₃H₃₁₁N₅₅O₆₀S
Relative Molecular Mass 4514.10
CAS Registry Number 317366-82-8
Source Synthetic
Storage Conditions -20 ± 5 °C
Application Alzheimer's Disease
Links / Documents:
Brochures:

Bachem product citations

M.van Gijsel-Bonnello et al., PLoS One, 12, e0175369 (2017)
Y.K.Kwon et al., Appl. Biol. Chem., (2016)
J.M.Griffin et al., PLoS One, 11, e0157483 (2016)
J.Byun et al., Cell Death Differ., 22, 959 (2015)
K.K.Modi et al., PLoS One, 9, e103606 (2014)
M.Jayalal L .P, J. Chosun Nat. Sci., 6, 143 (2013)
G.Mairet-Coello et al., Neuron, 78, 94 (2013)
M.Diaz-Moreno et al., Neurobiol. Aging, 34, 2623 (2013)
S.J.Choi et al., J. Med. Food, 16, 977 (2013)
V.Capurro et al., PLoS One, 8, e56870 (2013)
A.Cardinale et al., J. Biol. Chem., 287, 2618 (2012)
J.Graff et al., Nature, 483, 222 (2012)
J.M.Sanz et al., Br. J. Pharmacol., 167, 1702 (2012)
J.M.Sanz et al., Br. J. Pharmacol., 167, 1702 (2012)
V.Dinet et al., Aging Cell, 11, 683 (2012)
B.Maloney and D.K.Lahiri, Gene, 488, 1 (2011)
J.A.Bailey et al., Gene, 488, 13 (2011)
J.Bruban et al., Neurobiol. Dis., 42, 55 (2011)
J.K.Kim et al., J. Med. Food, 14, 304 (2011)
S.J.Choi et al., J. Med. Food, 14, 695 (2011)
Y.Uchida et al., FEBS Lett., 585, 651 (2011)
C.Bate et al., Mol. Neurodegener., 5, 13 (2010)
J.Bruban et al., Aging Cell, 8, 162 (2009)
J.F.Hou et al., Neurosci. Lett., 462, 294 (2009)
J.M.Sanz et al., J. Immunol., 182, 4378 (2009)
M.L.Giuffrida et al., J. Neurosci., 29, 10582 (2009)
P.T.Chang et al., Anal. Chem., 81, 6944 (2009)
C.Bate et al., Mol. Neurodegener., 3, 1 (2008)
V.Schaeffer et al., Neurochem. Int., 52, 948 (2008)
J.E.Lee et al., J. Neurochem., 100, 1703 (2007)
K.Parameshwaran et al., Synapse, 61, 367 (2007)
S.J.Choi et al., Mol. Cells, 24, 113 (2007)
A.Ignatov et al., Br. J. Pharmacol., 149, 490 (2006)
S.Brahmachari et al., J. Neurosci., 26, 4930 (2006)
U.Igbavboa et al., Neuroscience, 142, 655 (2006)
J.Y.Cho et al., Prog. Neuropsychopharmacol. Biol. Psychiatry, 29, 901 (2005)
C.Bate et al., J. Neuroinflammation, 1, 4 (2004)
H.S.Kim et al., Biol. Pharm. Bull., 27, 120 (2004)
M.H.Mohajeri et al., FEBS Lett., 562, 16 (2004)
E.Tsukamoto et al., J. Neurosci. Res., 73, 627 (2003)
F.Grassi et al., J. Physiol., 547, 147 (2003)
I.S.Coraci et al., Am. J. Pathol., 160, 101 (2002)
M.Ammassari-Teule et al., Neuroreport, 13, 1679 (2002)
Y.Zhang et al., J. Cell Biol., 156, 519 (2002)
Y.Zhang et al., J. Cell Biol., 156, 519 (2002)
D.K.Song et al., J. Neurochem., 76, 1326 (2001)
J.J.Yan et al., Br. J. Pharmacol., 133, 89 (2001)
C.M.Troy et al., J. Neurosci., 20, 1386 (2000)
Related products