Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4027991
Return to Previous Page
4027991

Availability: In stock

Amyloid β-Protein (42-1)
H-Ala-Ile-Val-Val-Gly-Gly-Val-Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-Gly-Val-Asp-Glu-Ala-Phe-Phe-Val-Leu-Lys-Gln-His-His-Val-Glu-Tyr-Gly-Ser-Asp-His-Arg-Phe-Glu-Ala-Asp-OH

4027991

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4027991.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 332.00
CHF 308.76 (7%)
4027991.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 589.00
CHF 547.77 (7%)

Details

Reverse sequence of Aβ 1-42 (H-1386, H-6466), inactive control for the Aβ.
Catalog Number H-3976
APC Number 62-0-81
One Letter Code AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
Synonyms β-Amyloid (42-1)
Molecular Formula C₂₀₃H₃₁₁N₅₅O₆₀S
Relative Molecular Mass 4514.10
CAS Registry Number [317366-82-8]
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Alzheimer's Disease
Links / Documents:
Brochures:

Bachem product citations

M.van Gijsel-Bonnello et al., PLoS One, 12, e0175369 (2017)
Y.K.Kwon et al., Appl. Biol. Chem., (2016)
J.M.Griffin et al., PLoS One, 11, e0157483 (2016)
J.Byun et al., Cell Death Differ., 22, 959 (2015)
K.K.Modi et al., PLoS One, 9, e103606 (2014)
M.Jayalal L .P, J. Chosun Nat. Sci., 6, 143 (2013)
V.Capurro et al., PLoS One, 8, e56870 (2013)
S.J.Choi et al., J. Med. Food, 16, 977 (2013)
M.Diaz-Moreno et al., Neurobiol. Aging, 34, 2623 (2013)
G.Mairet-Coello et al., Neuron, 78, 94 (2013)
A.Cardinale et al., J. Biol. Chem., 287, 2618 (2012)
V.Dinet et al., Aging Cell, 11, 683 (2012)
J.Graff et al., Nature, 483, 222 (2012)
J.M.Sanz et al., Br. J. Pharmacol., 167, 1702 (2012)
J.M.Sanz et al., Br. J. Pharmacol., 167, 1702 (2012)
J.A.Bailey et al., Gene, 488, 13 (2011)
J.Bruban et al., Neurobiol. Dis., 42, 55 (2011)
S.J.Choi et al., J. Med. Food, 14, 695 (2011)
J.K.Kim et al., J. Med. Food, 14, 304 (2011)
B.Maloney and D.K.Lahiri, Gene, 488, 1 (2011)
Y.Uchida et al., FEBS Lett., 585, 651 (2011)
C.Bate et al., Mol. Neurodegener., 5, 13 (2010)
J.Bruban et al., Aging Cell, 8, 162 (2009)
C.Cecchi et al., Biochim. Biophys. Acta, 1788, 2204 (2009)
P.T.Chang et al., Anal. Chem., 81, 6944 (2009)
M.L.Giuffrida et al., J. Neurosci., 29, 10582 (2009)
J.F.Hou et al., Neurosci. Lett., 462, 294 (2009)
J.M.Sanz et al., J. Immunol., 182, 4378 (2009)
C.Bate et al., Mol. Neurodegener., 3, 1 (2008)
V.Schaeffer et al., Neurochem. Int., 52, 948 (2008)
S.J.Choi et al., Mol. Cells, 24, 113 (2007)
J.E.Lee et al., J. Neurochem., 100, 1703 (2007)
K.Parameshwaran et al., Synapse, 61, 367 (2007)
S.Brahmachari et al., J. Neurosci., 26, 4930 (2006)
U.Igbavboa et al., Neuroscience, 142, 655 (2006)
A.Ignatov et al., Br. J. Pharmacol., 149, 490 (2006)
J.Y.Cho et al., Prog. Neuropsychopharmacol. Biol. Psychiatry, 29, 901 (2005)
C.Bate et al., J. Neuroinflammation, 1, 4 (2004)
H.S.Kim et al., Biol. Pharm. Bull., 27, 120 (2004)
M.H.Mohajeri et al., FEBS Lett., 562, 16 (2004)
F.Grassi et al., J. Physiol., 547, 147 (2003)
E.Tsukamoto et al., J. Neurosci. Res., 73, 627 (2003)
M.Ammassari-Teule et al., Neuroreport, 13, 1679 (2002)
I.S.Coraci et al., Am. J. Pathol., 160, 101 (2002)
Y.Zhang et al., J. Cell Biol., 156, 519 (2002)
Y.Zhang et al., J. Cell Biol., 156, 519 (2002)
D.K.Song et al., J. Neurochem., 76, 1326 (2001)
J.J.Yan et al., Br. J. Pharmacol., 133, 89 (2001)
C.M.Troy et al., J. Neurosci., 20, 1386 (2000)
Related products