×

Cookie Settings

We use cookies so that we can offer you the best possible website experience. This includes cookies which are necessary for the operations of the website, as well as cookies that are only used for anonymous statistical purposes, for comfort settings or to display personalized content. Please note that based on your settings, it is possible that not all functionalities of the website will be available. You can find further information in our privacy policy.

Please make your personal preference here:

Imprint

 
 
Shopping Cart - CHF 0.00

You have no items in your shopping cart.

  • Home  » 
  • 4027457
Return to Previous Page
4027457

Availability: In stock

Exendin-4 (3-39)
H-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH₂

4027457

Product No. Pack Size Available ADS InfoAnalytical Data Sheet List Price Online Order Price Qty
4027457.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 291.00
CHF 270.63 (7%)
4027457.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 500.00
CHF 465.00 (7%)

Details

Potent glucagon-like peptide 1 (GLP-1) receptor antagonist.
Catalog Number H-3864
APC Number 46-3-05
One Letter Code EGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH₂
Molecular Formula C₁₇₆H₂₇₂N₄₆O₅₈S
Relative Molecular Mass 3992.44
CAS Registry Number 196109-31-6
Source Synthetic
Storage Conditions -20 ± 5 °C
Keywords GLP-1 antagonist
Application Diabetes
Links / Documents:
Brochures:

Product citations

T.Perry and N.H.Greig, Trends Pharmacol. Sci., 24, 377 (2003)